Providencia lanzhouensis: ACIH2S_18065 Help Entry ACIH2S_18065      CDS       T11188                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism plaz  Providencia lanzhouensis Pathway plaz02024   Quorum sensing plaz03018   RNA degradation Brite KEGG Orthology (KO) [BR:plaz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ACIH2S_18065 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ACIH2S_18065 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:plaz03019]     ACIH2S_18065 (hfq)    03036 Chromosome and associated proteins [BR:plaz03036]     ACIH2S_18065 (hfq) Messenger RNA biogenesis [BR:plaz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ACIH2S_18065 (hfq) Chromosome and associated proteins [BR:plaz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ACIH2S_18065 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  XTS06806 LinkDB All DBs Position complement(3870208..3870504) Genome browser AA seq 98 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARPVSHHSGTGTAGAGNGNYHGGASAGQDGESAE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccgttcctgaacgcattacgtcgtgaaagggtt ccggtctctatttatttagttaatggtattaaattgcagggtcaaatcgaatcttttgac caatttgttattttgctgaaaaacacagttagccagatggtttataaacacgctatctct actgtggttccagcacgccctgtttctcatcatagcggtactggtactgctggcgctggc aatggcaactaccacggtggtgcttctgctgggcaagatggcgaatcagctgagtaa

DBGET integrated database retrieval system