Palleronia sp. LCG004: RVY76_08065 Help Entry RVY76_08065       CDS       T09465                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plcg  Palleronia sp. LCG004 Pathway plcg01100   Metabolic pathways plcg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plcg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RVY76_08065    00074 Mycolic acid biosynthesis     RVY76_08065   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RVY76_08065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WOI55022 UniProt:  A0AAU0HLY7 LinkDB All DBs Position complement(1675367..1675606) Genome browser AA seq 79 aa AA seqDB search MSEGDIETRVRKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDD AAETIQTFGDAVKFIKEAV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaggcgatatcgagacgcgcgtcagaaagatcgttgttgagcatctgggcgtc gaggaagagaaagtgaccgagaacgcctcgttcatcgacgatctcggggccgacagcctg gataccgtcgagctggtcatggcgttcgaggaagaattcgggatcgagatccccgatgac gcagccgagaccatccagacgttcggcgatgccgtgaagttcatcaaggaagccgtctga

DBGET integrated database retrieval system