KEGG   Palleronia sp. LCG004: RVY76_09865
Entry
RVY76_09865       CDS       T09465                                 
Name
(GenBank) acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha
  KO
K01965  propionyl-CoA carboxylase alpha subunit [EC:6.4.1.3]
Organism
plcg  Palleronia sp. LCG004
Pathway
plcg00280  Valine, leucine and isoleucine degradation
plcg00630  Glyoxylate and dicarboxylate metabolism
plcg00640  Propanoate metabolism
plcg01100  Metabolic pathways
plcg01110  Biosynthesis of secondary metabolites
plcg01120  Microbial metabolism in diverse environments
plcg01200  Carbon metabolism
Module
plcg_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:plcg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RVY76_09865
   00640 Propanoate metabolism
    RVY76_09865
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RVY76_09865
Enzymes [BR:plcg01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     RVY76_09865
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N PCC_BT Biotin_carb_C Biotin_lipoyl ATP-grasp Dala_Dala_lig_C Biotin_lipoyl_2 RimK GARS_A ATP-grasp_5 DUF2118 HlyD_3 HlyD_D23 ATPgrasp_ST QRPTase_N GCV_H
Other DBs
NCBI-ProteinID: WOI55351
LinkDB
Position
complement(2019825..2021873)
AA seq 682 aa
MFKKILIANRGEIACRVIKTARRMGISTVAIYSDADRNALHVRMADEAVHIGPAQANQSY
ISIDRVMEAIRSSGADAVHPGYGFLSENPKFAAALDEAGIAFIGPPKGAIEAMGDKITSK
KLADEAGVSTVPGHMGLIEDADEAVAIATEIGFPVMLKASAGGGGKGMRIAWDEAEAREG
FQSARNEATSSFGDDRIFIEKFVTQPRHIEIQVLADTHGNTIYLGERECSIQRRNQKVIE
EAPSPFLDEATRRAMGEQACALAAAVGYTSAGTVEFIVDGDRNFYFLEMNTRLQVEHPVT
ELVTGIDLVEQMIRVAAGEALSVAQSDVTLTGWAIESRLYAEDPYRGFLPSIGRLTRYRP
PAERAAGPLAEAGKWHEPDAAEGDVAVRNDTGVFEGGEISMHYDPMIAKLCTWAPDRAAA
IEAMRIALDRFEVEGIGHNLPFLSAVMDHPKFAEGEMTTAFIGEEYPDGFSGVELSPEDL
RRVASAAAAMNRVAEIRRTRISGRMDNHERRIGDDWVVFAQGREMPVRIAADRDGATVRH
EDGTEMRVSASWQPGEPLARLEVDGRPLVLKVGRVTGGYRLRTRGADLDVLVYTPRQAEL
KRHMPEKEEADTSKLLLCPMPGLVVKIDVDEGQEVQQGQALCTIEAMKMENILRAERKGT
VARINASEGDSLAVDDIIMEFD
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgttcaagaagatcctgatcgccaatcgcggcgagatcgcctgccgtgtcatcaagacc
gcacgtcggatgggcatttcgacggtcgcgatctattccgatgcggatcgcaacgcgctg
catgtccgcatggccgacgaggcggtgcatatcgggccggcccaggcgaaccagtcctac
atctcgatcgacagggtgatggaggcgatccgcagctcgggcgcggatgccgttcatccc
ggctacggtttcctgagcgagaacccgaaattcgcggccgcgctggacgaggccggcatc
gccttcatcgggccgcccaagggggcgatcgaggcgatgggcgacaagatcacctcgaag
aagctcgccgacgaggccggcgtctcgacggtgccggggcatatgggcctgatcgaggat
gccgacgaggccgttgcgatcgccactgagatcggctttcccgtcatgctcaaggcctcg
gccgggggcggcggcaagggcatgcgcatcgcttgggacgaggcggaagcgcgcgagggg
ttccagagcgcgcggaacgaggccacgagttcgttcggcgacgaccggatcttcatcgag
aagttcgtgacccagccccgccatatcgagatccaggtcctcgccgacacgcatggcaac
acgatctatctgggcgagcgggaatgctcgatccagcggcggaaccagaaggtcatcgaa
gaggcaccgtcgcccttcctcgacgaggcgacccgcagggcgatgggcgagcaggcctgc
gcgctggccgcggccgtgggctataccagtgccgggacggtcgagttcatcgtggacggg
gaccgcaatttctacttcctcgagatgaatacccgtctgcaggtggagcatccggtgacc
gaactcgtcaccgggatcgatctcgtcgagcagatgatccgagtcgcggccggtgaggcg
ctctcggtcgcgcaatccgacgtgacgcttacggggtgggcgatcgagagccggctctat
gccgaggatccctatcgcggcttcctgccctcgatcgggcggctgacccgctatcgtccg
cccgcggaacgcgccgccgggccgcttgccgaggcaggcaagtggcacgagcccgatgcc
gcggagggcgatgtcgcggtccgcaacgacacgggcgtgttcgagggcggcgagatctcg
atgcattacgacccgatgatcgcgaagctctgcacctgggcacccgaccgtgcggcggcg
atcgaggcgatgcgcatcgctctcgaccggttcgaggtcgaggggatcgggcacaacctg
ccgttcctgagcgcggtgatggaccatccgaaattcgcggaaggcgagatgacgaccgcc
ttcatcggcgaggaatatcccgacggcttttccggcgtggagctttcgcccgaagacctc
cggcgcgtggcatcggccgcggccgcgatgaaccgcgtggccgagatccgccggacccgc
atctcggggcggatggacaatcacgagcgtcggatcggcgacgattgggtcgtgttcgcg
cagggcagggagatgccggtcaggatcgcggccgatcgcgacggcgcgacggtgcgccac
gaggacggaacggaaatgcgggtgagcgcttcctggcagccgggcgagccgctcgcgcgg
ctcgaggtcgacggacgcccgctcgtcctgaaggtgggacgggtgaccggcggctaccgg
ctgagaacccgaggtgcggatctcgacgtgctggtctacacgccccgtcaggccgagctc
aagcgccacatgcccgagaaggaggaggccgatacctccaaactgctgctctgcccgatg
ccggggctcgtcgtgaagatcgacgtggacgaggggcaggaagtgcagcaggggcaggcg
ctctgcacgatcgaggcgatgaagatggagaacatccttcgcgccgaacgcaagggaacg
gtcgcccggatcaacgcgtcggagggcgacagccttgccgtcgacgatatcatcatggaa
ttcgactga

DBGET integrated database retrieval system