Palleronia sp. LCG004: RVY76_10105 Help Entry RVY76_10105       CDS       T09465                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism plcg  Palleronia sp. LCG004 Brite KEGG Orthology (KO) [BR:plcg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:plcg03032]     RVY76_10105    03036 Chromosome and associated proteins [BR:plcg03036]     RVY76_10105    03400 DNA repair and recombination proteins [BR:plcg03400]     RVY76_10105 DNA replication proteins [BR:plcg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RVY76_10105 Chromosome and associated proteins [BR:plcg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RVY76_10105 DNA repair and recombination proteins [BR:plcg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RVY76_10105 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 SasG_E Motif Other DBs NCBI-ProteinID:  WOI55397 LinkDB All DBs Position complement(2065403..2065693) Genome browser AA seq 96 aa AA seqDB search MATKPMTKTQLVAALAEKMDSDKKSAGEALDAITEVITEEVSGGGAVTLPGVGKIYCRER PERMVRNPATGEQIKKDADKVVKMTIAKALKDSVNN NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaaaccgatgaccaagacgcagctcgtcgcagcgctggccgagaagatggac agcgacaagaaatccgccggcgaagcactcgatgcgatcaccgaggtcatcaccgaggaa gtttcgggtggtggtgccgtgacccttccgggcgtcggcaagatctattgccgcgagcgt cccgagcgcatggtccgcaatcccgccaccggcgagcagatcaagaaggatgccgacaag gtcgtcaagatgacgatcgccaaggccctgaaggacagcgtcaacaactga

DBGET integrated database retrieval system