Pleionea litopenaei: Q9312_13410 Help Entry Q9312_13410       CDS       T09336                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism plei  Pleionea litopenaei Brite KEGG Orthology (KO) [BR:plei00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:plei03036]     Q9312_13410 Chromosome and associated proteins [BR:plei03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Q9312_13410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB TSC22 bZIP_1 Herpes_BLRF2 CENP-H Spectrin DivIC GAS ADIP COG3_N SAS4 AKNA CLZ NRBF2 Peptidase_S49 SnoaL_5 YabA V_ATPase_I bZIP_2 Motif Other DBs NCBI-ProteinID:  WMS86217 UniProt:  A0AA51RRC6 LinkDB All DBs Position complement(2985657..2985857) Genome browser AA seq 66 aa AA seqDB search MENSEISQLEGRVEQLLERFHQLQQENRSLKVKQDELIADRARLLEKNKLASEKIESIVT RLKSMG NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggaaaattcagaaatttctcaacttgaagggcgcgttgagcaacttttagaacgattt caccagttacaacaagaaaatcgctcattgaaagttaagcaagacgagctgatcgctgat cgagcgcgtctgcttgaaaagaataaactcgcctcagagaaaatcgaatccatcgttacg cgcctgaaatcaatggggtaa

DBGET integrated database retrieval system