Pleomorphomonas sp. SM30: OHA_1_01891 Help Entry OHA_1_01891       CDS       T05766                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism pleo  Pleomorphomonas sp. SM30 Brite KEGG Orthology (KO) [BR:pleo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pleo03110]     OHA_1_01891 (groS)    03029 Mitochondrial biogenesis [BR:pleo03029]     OHA_1_01891 (groS) Chaperones and folding catalysts [BR:pleo03110]  Heat shock proteins   HSP10    OHA_1_01891 (groS) Mitochondrial biogenesis [BR:pleo03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     OHA_1_01891 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  BBE72302 LinkDB All DBs Position 1:2034697..2034984 Genome browser AA seq 95 aa AA seqDB search MKFRPLHDRVVVRRVESEERTAGGIIIPDTAKEKPQQGEVIAVGSGARNEKGEIVALDVK AGDRVLFGKWSGTEVKIDGQDLLIMKESDIMGIVG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaagttccgcccgcttcacgatcgcgtggtcgttcgtcgtgtcgagtccgaagagcgg accgccggcggcatcatcatcccggataccgccaaggagaagccgcagcagggcgaagtg atcgccgtcggctccggcgcccggaacgagaagggtgagatcgtcgccctcgacgtcaag gccggcgatcgcgtgctgttcggcaagtggtccggcaccgaggtgaagatcgacggtcag gatctcctcatcatgaaggagtccgacatcatgggcatcgtcggctga

DBGET integrated database retrieval system