KEGG   Peromyscus leucopus (white-footed mouse): 114698582
Entry
114698582         CDS       T07241                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
pleu  Peromyscus leucopus (white-footed mouse)
Pathway
pleu01521  EGFR tyrosine kinase inhibitor resistance
pleu01522  Endocrine resistance
pleu04010  MAPK signaling pathway
pleu04012  ErbB signaling pathway
pleu04014  Ras signaling pathway
pleu04015  Rap1 signaling pathway
pleu04062  Chemokine signaling pathway
pleu04068  FoxO signaling pathway
pleu04071  Sphingolipid signaling pathway
pleu04072  Phospholipase D signaling pathway
pleu04137  Mitophagy - animal
pleu04140  Autophagy - animal
pleu04150  mTOR signaling pathway
pleu04151  PI3K-Akt signaling pathway
pleu04210  Apoptosis
pleu04211  Longevity regulating pathway
pleu04213  Longevity regulating pathway - multiple species
pleu04218  Cellular senescence
pleu04360  Axon guidance
pleu04370  VEGF signaling pathway
pleu04371  Apelin signaling pathway
pleu04540  Gap junction
pleu04550  Signaling pathways regulating pluripotency of stem cells
pleu04625  C-type lectin receptor signaling pathway
pleu04650  Natural killer cell mediated cytotoxicity
pleu04660  T cell receptor signaling pathway
pleu04662  B cell receptor signaling pathway
pleu04664  Fc epsilon RI signaling pathway
pleu04714  Thermogenesis
pleu04720  Long-term potentiation
pleu04722  Neurotrophin signaling pathway
pleu04725  Cholinergic synapse
pleu04726  Serotonergic synapse
pleu04730  Long-term depression
pleu04810  Regulation of actin cytoskeleton
pleu04910  Insulin signaling pathway
pleu04912  GnRH signaling pathway
pleu04915  Estrogen signaling pathway
pleu04916  Melanogenesis
pleu04917  Prolactin signaling pathway
pleu04919  Thyroid hormone signaling pathway
pleu04921  Oxytocin signaling pathway
pleu04926  Relaxin signaling pathway
pleu04929  GnRH secretion
pleu04933  AGE-RAGE signaling pathway in diabetic complications
pleu04935  Growth hormone synthesis, secretion and action
pleu05010  Alzheimer disease
pleu05022  Pathways of neurodegeneration - multiple diseases
pleu05034  Alcoholism
pleu05160  Hepatitis C
pleu05161  Hepatitis B
pleu05163  Human cytomegalovirus infection
pleu05165  Human papillomavirus infection
pleu05166  Human T-cell leukemia virus 1 infection
pleu05167  Kaposi sarcoma-associated herpesvirus infection
pleu05170  Human immunodeficiency virus 1 infection
pleu05200  Pathways in cancer
pleu05203  Viral carcinogenesis
pleu05205  Proteoglycans in cancer
pleu05206  MicroRNAs in cancer
pleu05207  Chemical carcinogenesis - receptor activation
pleu05208  Chemical carcinogenesis - reactive oxygen species
pleu05210  Colorectal cancer
pleu05211  Renal cell carcinoma
pleu05213  Endometrial cancer
pleu05214  Glioma
pleu05215  Prostate cancer
pleu05216  Thyroid cancer
pleu05218  Melanoma
pleu05219  Bladder cancer
pleu05220  Chronic myeloid leukemia
pleu05221  Acute myeloid leukemia
pleu05223  Non-small cell lung cancer
pleu05224  Breast cancer
pleu05225  Hepatocellular carcinoma
pleu05226  Gastric cancer
pleu05230  Central carbon metabolism in cancer
pleu05231  Choline metabolism in cancer
pleu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pleu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pleu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114698582 (Nras)
   04012 ErbB signaling pathway
    114698582 (Nras)
   04014 Ras signaling pathway
    114698582 (Nras)
   04015 Rap1 signaling pathway
    114698582 (Nras)
   04370 VEGF signaling pathway
    114698582 (Nras)
   04371 Apelin signaling pathway
    114698582 (Nras)
   04068 FoxO signaling pathway
    114698582 (Nras)
   04072 Phospholipase D signaling pathway
    114698582 (Nras)
   04071 Sphingolipid signaling pathway
    114698582 (Nras)
   04151 PI3K-Akt signaling pathway
    114698582 (Nras)
   04150 mTOR signaling pathway
    114698582 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114698582 (Nras)
   04137 Mitophagy - animal
    114698582 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    114698582 (Nras)
   04218 Cellular senescence
    114698582 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114698582 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    114698582 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114698582 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114698582 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    114698582 (Nras)
   04660 T cell receptor signaling pathway
    114698582 (Nras)
   04662 B cell receptor signaling pathway
    114698582 (Nras)
   04664 Fc epsilon RI signaling pathway
    114698582 (Nras)
   04062 Chemokine signaling pathway
    114698582 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114698582 (Nras)
   04929 GnRH secretion
    114698582 (Nras)
   04912 GnRH signaling pathway
    114698582 (Nras)
   04915 Estrogen signaling pathway
    114698582 (Nras)
   04917 Prolactin signaling pathway
    114698582 (Nras)
   04921 Oxytocin signaling pathway
    114698582 (Nras)
   04926 Relaxin signaling pathway
    114698582 (Nras)
   04935 Growth hormone synthesis, secretion and action
    114698582 (Nras)
   04919 Thyroid hormone signaling pathway
    114698582 (Nras)
   04916 Melanogenesis
    114698582 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    114698582 (Nras)
   04726 Serotonergic synapse
    114698582 (Nras)
   04720 Long-term potentiation
    114698582 (Nras)
   04730 Long-term depression
    114698582 (Nras)
   04722 Neurotrophin signaling pathway
    114698582 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    114698582 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    114698582 (Nras)
   04213 Longevity regulating pathway - multiple species
    114698582 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    114698582 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114698582 (Nras)
   05206 MicroRNAs in cancer
    114698582 (Nras)
   05205 Proteoglycans in cancer
    114698582 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    114698582 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    114698582 (Nras)
   05203 Viral carcinogenesis
    114698582 (Nras)
   05230 Central carbon metabolism in cancer
    114698582 (Nras)
   05231 Choline metabolism in cancer
    114698582 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114698582 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114698582 (Nras)
   05225 Hepatocellular carcinoma
    114698582 (Nras)
   05226 Gastric cancer
    114698582 (Nras)
   05214 Glioma
    114698582 (Nras)
   05216 Thyroid cancer
    114698582 (Nras)
   05221 Acute myeloid leukemia
    114698582 (Nras)
   05220 Chronic myeloid leukemia
    114698582 (Nras)
   05218 Melanoma
    114698582 (Nras)
   05211 Renal cell carcinoma
    114698582 (Nras)
   05219 Bladder cancer
    114698582 (Nras)
   05215 Prostate cancer
    114698582 (Nras)
   05213 Endometrial cancer
    114698582 (Nras)
   05224 Breast cancer
    114698582 (Nras)
   05223 Non-small cell lung cancer
    114698582 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114698582 (Nras)
   05170 Human immunodeficiency virus 1 infection
    114698582 (Nras)
   05161 Hepatitis B
    114698582 (Nras)
   05160 Hepatitis C
    114698582 (Nras)
   05163 Human cytomegalovirus infection
    114698582 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114698582 (Nras)
   05165 Human papillomavirus infection
    114698582 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114698582 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    114698582 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    114698582 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114698582 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    114698582 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114698582 (Nras)
   01522 Endocrine resistance
    114698582 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pleu04131]
    114698582 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pleu04147]
    114698582 (Nras)
   04031 GTP-binding proteins [BR:pleu04031]
    114698582 (Nras)
Membrane trafficking [BR:pleu04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    114698582 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    114698582 (Nras)
Exosome [BR:pleu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114698582 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   114698582 (Nras)
  Exosomal proteins of breast cancer cells
   114698582 (Nras)
  Exosomal proteins of colorectal cancer cells
   114698582 (Nras)
GTP-binding proteins [BR:pleu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    114698582 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 114698582
NCBI-ProteinID: XP_028733151
LinkDB
Position
6:77298167..77309806
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLHSNDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgctttgaca
atccagttaatccagaaccattttgtggatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggtaattgatggtgagacttgtctgttggacatactggacacagctgga
caagaggaatacagtgccatgagagaccaatacatgaggacaggcgaaggattcctctgc
gtatttgccatcaacaatagcaaatcatttgcagatattaacctctacagggagcagatt
aagcgagtgaaagactctgatgatgtgcctatggtactggtagggaacaaatgtgacttg
cccacaaggacagttgacacaaagcaagcccatgagctggccaagagttacggaattcca
ttcattgaaacctcagctaagacccgacagggtgtggaagatgccttttacacactggta
agggagatacgccagtaccgaatgaaaaagctccacagcaatgatgatggcacccaaggt
tgtatggggctgccctgtgtggtgatgtag

DBGET integrated database retrieval system