KEGG   Peromyscus leucopus (white-footed mouse): 114699672
Entry
114699672         CDS       T07241                                 
Symbol
Ndufs3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
pleu  Peromyscus leucopus (white-footed mouse)
Pathway
pleu00190  Oxidative phosphorylation
pleu01100  Metabolic pathways
pleu04714  Thermogenesis
pleu04723  Retrograde endocannabinoid signaling
pleu04932  Non-alcoholic fatty liver disease
pleu05010  Alzheimer disease
pleu05012  Parkinson disease
pleu05014  Amyotrophic lateral sclerosis
pleu05016  Huntington disease
pleu05020  Prion disease
pleu05022  Pathways of neurodegeneration - multiple diseases
pleu05208  Chemical carcinogenesis - reactive oxygen species
pleu05415  Diabetic cardiomyopathy
Module
pleu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:pleu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    114699672 (Ndufs3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    114699672 (Ndufs3)
  09159 Environmental adaptation
   04714 Thermogenesis
    114699672 (Ndufs3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    114699672 (Ndufs3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114699672 (Ndufs3)
   05012 Parkinson disease
    114699672 (Ndufs3)
   05014 Amyotrophic lateral sclerosis
    114699672 (Ndufs3)
   05016 Huntington disease
    114699672 (Ndufs3)
   05020 Prion disease
    114699672 (Ndufs3)
   05022 Pathways of neurodegeneration - multiple diseases
    114699672 (Ndufs3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    114699672 (Ndufs3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    114699672 (Ndufs3)
Enzymes [BR:pleu01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     114699672 (Ndufs3)
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-GeneID: 114699672
NCBI-ProteinID: XP_028734670
LinkDB
Position
4:complement(66612210..66619874)
AA seq 263 aa
MAAAAARVWWRGLVGAASVARGTERPSVLLQRVRRESAAADTRPTVRPRDEVTHKQLSAF
GEYVAEILPKYVQHVQVTCLNELEICIHPDGVIPTLTFLRDHTNAQFKSLADMTAVDVPT
RQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESVVSVHKAANWYEREVWDMFGVFFVNH
PDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVEFAQEFRKFDLNSPWEA
FPAYRQPPESLKLEAGDKKPEAK
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcggctgccgcagccagggtctggtggcgcgggctcgtaggcgccgcttccgtagcc
agggggactgagcgaccctcagtgctgttgcagcgggtgaggagggagagcgcggcggct
gacacgcgccccactgtcagaccgcgggatgaggtaacccacaagcagctctcagcattt
ggagagtatgtggctgaaatcctacccaagtatgtccaacacgttcaggtgacgtgcctt
aatgagttagaaatctgtatccatcctgatggagtcatcccaacgctgactttcctcagg
gaccacaccaatgcacaattcaaatccttggctgacatgacagcggtagatgtcccaact
cggcagaaccgctttgagattgtctacaacctgctgtctctgcgcttcaactctcggatc
cgtgtgaagacctatacagatgagctgacgcccattgagtccgtagtctctgtgcacaag
gcagccaactggtatgagagggaggtctgggacatgtttggagttttctttgttaaccac
cctgatctaagaaggatcctgacagactatggcttcgagggacatcctttccggaaagac
tttcccctctctggctatgttgagctccgttatgacgatgaggtgaagcgggtggtagct
gaaccagtggagtttgcccaagaattccgcaagtttgacctcaacagtccctgggaggct
ttccctgcctatcgtcagcctcctgagagtctgaagcttgaagctggagacaagaagcct
gaagccaagtag

DBGET integrated database retrieval system