KEGG   Peromyscus leucopus (white-footed mouse): 114704332
Entry
114704332         CDS       T07241                                 
Symbol
Mapk3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pleu  Peromyscus leucopus (white-footed mouse)
Pathway
pleu01521  EGFR tyrosine kinase inhibitor resistance
pleu01522  Endocrine resistance
pleu01524  Platinum drug resistance
pleu04010  MAPK signaling pathway
pleu04012  ErbB signaling pathway
pleu04014  Ras signaling pathway
pleu04015  Rap1 signaling pathway
pleu04022  cGMP-PKG signaling pathway
pleu04024  cAMP signaling pathway
pleu04062  Chemokine signaling pathway
pleu04066  HIF-1 signaling pathway
pleu04068  FoxO signaling pathway
pleu04071  Sphingolipid signaling pathway
pleu04072  Phospholipase D signaling pathway
pleu04114  Oocyte meiosis
pleu04140  Autophagy - animal
pleu04148  Efferocytosis
pleu04150  mTOR signaling pathway
pleu04151  PI3K-Akt signaling pathway
pleu04210  Apoptosis
pleu04218  Cellular senescence
pleu04261  Adrenergic signaling in cardiomyocytes
pleu04270  Vascular smooth muscle contraction
pleu04350  TGF-beta signaling pathway
pleu04360  Axon guidance
pleu04370  VEGF signaling pathway
pleu04371  Apelin signaling pathway
pleu04380  Osteoclast differentiation
pleu04510  Focal adhesion
pleu04517  IgSF CAM signaling
pleu04520  Adherens junction
pleu04540  Gap junction
pleu04550  Signaling pathways regulating pluripotency of stem cells
pleu04611  Platelet activation
pleu04613  Neutrophil extracellular trap formation
pleu04620  Toll-like receptor signaling pathway
pleu04621  NOD-like receptor signaling pathway
pleu04625  C-type lectin receptor signaling pathway
pleu04650  Natural killer cell mediated cytotoxicity
pleu04657  IL-17 signaling pathway
pleu04658  Th1 and Th2 cell differentiation
pleu04659  Th17 cell differentiation
pleu04660  T cell receptor signaling pathway
pleu04662  B cell receptor signaling pathway
pleu04664  Fc epsilon RI signaling pathway
pleu04666  Fc gamma R-mediated phagocytosis
pleu04668  TNF signaling pathway
pleu04713  Circadian entrainment
pleu04720  Long-term potentiation
pleu04722  Neurotrophin signaling pathway
pleu04723  Retrograde endocannabinoid signaling
pleu04724  Glutamatergic synapse
pleu04725  Cholinergic synapse
pleu04726  Serotonergic synapse
pleu04730  Long-term depression
pleu04810  Regulation of actin cytoskeleton
pleu04910  Insulin signaling pathway
pleu04912  GnRH signaling pathway
pleu04914  Progesterone-mediated oocyte maturation
pleu04915  Estrogen signaling pathway
pleu04916  Melanogenesis
pleu04917  Prolactin signaling pathway
pleu04919  Thyroid hormone signaling pathway
pleu04921  Oxytocin signaling pathway
pleu04926  Relaxin signaling pathway
pleu04928  Parathyroid hormone synthesis, secretion and action
pleu04929  GnRH secretion
pleu04930  Type II diabetes mellitus
pleu04933  AGE-RAGE signaling pathway in diabetic complications
pleu04934  Cushing syndrome
pleu04935  Growth hormone synthesis, secretion and action
pleu04960  Aldosterone-regulated sodium reabsorption
pleu05010  Alzheimer disease
pleu05020  Prion disease
pleu05022  Pathways of neurodegeneration - multiple diseases
pleu05034  Alcoholism
pleu05132  Salmonella infection
pleu05133  Pertussis
pleu05135  Yersinia infection
pleu05140  Leishmaniasis
pleu05142  Chagas disease
pleu05145  Toxoplasmosis
pleu05152  Tuberculosis
pleu05160  Hepatitis C
pleu05161  Hepatitis B
pleu05163  Human cytomegalovirus infection
pleu05164  Influenza A
pleu05165  Human papillomavirus infection
pleu05166  Human T-cell leukemia virus 1 infection
pleu05167  Kaposi sarcoma-associated herpesvirus infection
pleu05170  Human immunodeficiency virus 1 infection
pleu05171  Coronavirus disease - COVID-19
pleu05200  Pathways in cancer
pleu05203  Viral carcinogenesis
pleu05205  Proteoglycans in cancer
pleu05206  MicroRNAs in cancer
pleu05207  Chemical carcinogenesis - receptor activation
pleu05208  Chemical carcinogenesis - reactive oxygen species
pleu05210  Colorectal cancer
pleu05211  Renal cell carcinoma
pleu05212  Pancreatic cancer
pleu05213  Endometrial cancer
pleu05214  Glioma
pleu05215  Prostate cancer
pleu05216  Thyroid cancer
pleu05218  Melanoma
pleu05219  Bladder cancer
pleu05220  Chronic myeloid leukemia
pleu05221  Acute myeloid leukemia
pleu05223  Non-small cell lung cancer
pleu05224  Breast cancer
pleu05225  Hepatocellular carcinoma
pleu05226  Gastric cancer
pleu05230  Central carbon metabolism in cancer
pleu05231  Choline metabolism in cancer
pleu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pleu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pleu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114704332 (Mapk3)
   04012 ErbB signaling pathway
    114704332 (Mapk3)
   04014 Ras signaling pathway
    114704332 (Mapk3)
   04015 Rap1 signaling pathway
    114704332 (Mapk3)
   04350 TGF-beta signaling pathway
    114704332 (Mapk3)
   04370 VEGF signaling pathway
    114704332 (Mapk3)
   04371 Apelin signaling pathway
    114704332 (Mapk3)
   04668 TNF signaling pathway
    114704332 (Mapk3)
   04066 HIF-1 signaling pathway
    114704332 (Mapk3)
   04068 FoxO signaling pathway
    114704332 (Mapk3)
   04072 Phospholipase D signaling pathway
    114704332 (Mapk3)
   04071 Sphingolipid signaling pathway
    114704332 (Mapk3)
   04024 cAMP signaling pathway
    114704332 (Mapk3)
   04022 cGMP-PKG signaling pathway
    114704332 (Mapk3)
   04151 PI3K-Akt signaling pathway
    114704332 (Mapk3)
   04150 mTOR signaling pathway
    114704332 (Mapk3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    114704332 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114704332 (Mapk3)
   04148 Efferocytosis
    114704332 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    114704332 (Mapk3)
   04210 Apoptosis
    114704332 (Mapk3)
   04218 Cellular senescence
    114704332 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114704332 (Mapk3)
   04520 Adherens junction
    114704332 (Mapk3)
   04540 Gap junction
    114704332 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    114704332 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114704332 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    114704332 (Mapk3)
   04613 Neutrophil extracellular trap formation
    114704332 (Mapk3)
   04620 Toll-like receptor signaling pathway
    114704332 (Mapk3)
   04621 NOD-like receptor signaling pathway
    114704332 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    114704332 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    114704332 (Mapk3)
   04660 T cell receptor signaling pathway
    114704332 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    114704332 (Mapk3)
   04659 Th17 cell differentiation
    114704332 (Mapk3)
   04657 IL-17 signaling pathway
    114704332 (Mapk3)
   04662 B cell receptor signaling pathway
    114704332 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    114704332 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    114704332 (Mapk3)
   04062 Chemokine signaling pathway
    114704332 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114704332 (Mapk3)
   04929 GnRH secretion
    114704332 (Mapk3)
   04912 GnRH signaling pathway
    114704332 (Mapk3)
   04915 Estrogen signaling pathway
    114704332 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    114704332 (Mapk3)
   04917 Prolactin signaling pathway
    114704332 (Mapk3)
   04921 Oxytocin signaling pathway
    114704332 (Mapk3)
   04926 Relaxin signaling pathway
    114704332 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    114704332 (Mapk3)
   04919 Thyroid hormone signaling pathway
    114704332 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    114704332 (Mapk3)
   04916 Melanogenesis
    114704332 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114704332 (Mapk3)
   04270 Vascular smooth muscle contraction
    114704332 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    114704332 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    114704332 (Mapk3)
   04725 Cholinergic synapse
    114704332 (Mapk3)
   04726 Serotonergic synapse
    114704332 (Mapk3)
   04720 Long-term potentiation
    114704332 (Mapk3)
   04730 Long-term depression
    114704332 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    114704332 (Mapk3)
   04722 Neurotrophin signaling pathway
    114704332 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    114704332 (Mapk3)
   04380 Osteoclast differentiation
    114704332 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    114704332 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114704332 (Mapk3)
   05206 MicroRNAs in cancer
    114704332 (Mapk3)
   05205 Proteoglycans in cancer
    114704332 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    114704332 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    114704332 (Mapk3)
   05203 Viral carcinogenesis
    114704332 (Mapk3)
   05230 Central carbon metabolism in cancer
    114704332 (Mapk3)
   05231 Choline metabolism in cancer
    114704332 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114704332 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114704332 (Mapk3)
   05212 Pancreatic cancer
    114704332 (Mapk3)
   05225 Hepatocellular carcinoma
    114704332 (Mapk3)
   05226 Gastric cancer
    114704332 (Mapk3)
   05214 Glioma
    114704332 (Mapk3)
   05216 Thyroid cancer
    114704332 (Mapk3)
   05221 Acute myeloid leukemia
    114704332 (Mapk3)
   05220 Chronic myeloid leukemia
    114704332 (Mapk3)
   05218 Melanoma
    114704332 (Mapk3)
   05211 Renal cell carcinoma
    114704332 (Mapk3)
   05219 Bladder cancer
    114704332 (Mapk3)
   05215 Prostate cancer
    114704332 (Mapk3)
   05213 Endometrial cancer
    114704332 (Mapk3)
   05224 Breast cancer
    114704332 (Mapk3)
   05223 Non-small cell lung cancer
    114704332 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114704332 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    114704332 (Mapk3)
   05161 Hepatitis B
    114704332 (Mapk3)
   05160 Hepatitis C
    114704332 (Mapk3)
   05171 Coronavirus disease - COVID-19
    114704332 (Mapk3)
   05164 Influenza A
    114704332 (Mapk3)
   05163 Human cytomegalovirus infection
    114704332 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114704332 (Mapk3)
   05165 Human papillomavirus infection
    114704332 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114704332 (Mapk3)
   05135 Yersinia infection
    114704332 (Mapk3)
   05133 Pertussis
    114704332 (Mapk3)
   05152 Tuberculosis
    114704332 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114704332 (Mapk3)
   05140 Leishmaniasis
    114704332 (Mapk3)
   05142 Chagas disease
    114704332 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114704332 (Mapk3)
   05020 Prion disease
    114704332 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    114704332 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    114704332 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114704332 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    114704332 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    114704332 (Mapk3)
   04934 Cushing syndrome
    114704332 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114704332 (Mapk3)
   01524 Platinum drug resistance
    114704332 (Mapk3)
   01522 Endocrine resistance
    114704332 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pleu01001]
    114704332 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pleu03036]
    114704332 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pleu04147]
    114704332 (Mapk3)
Enzymes [BR:pleu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114704332 (Mapk3)
Protein kinases [BR:pleu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114704332 (Mapk3)
Chromosome and associated proteins [BR:pleu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     114704332 (Mapk3)
Exosome [BR:pleu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114704332 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 114704332
NCBI-ProteinID: XP_028741324
LinkDB
Position
1:complement(77862219..77903474)
AA seq 425 aa
MASGVARPQASVWPLVVTGHDVITGPTVGGREGGAAGGAAGGGGRSGDGGGGGSGGGGGE
PREPLGSAGGPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKIS
PFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLK
SQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPE
HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQL
NHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFN
PNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPG
APEAP
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcttcaggtgtggccagacctcaggcatctgtatggcccttggtggtaacgggccat
gatgtcatcacaggccccactgtgggcgggcgggagggcggggccgcgggcggggccgcg
gggggaggcgggaggagtggagatggcggcggcggcggctccgggggcgggggcggggag
ccccgggagccgctggggtcggccgggggtcccggggaggtggaggtggtgaagggacag
ccattcgacgtgggcccacgctacacgcagttgcagtacatcggcgaaggcgcgtacggc
atggtcagctctgcttatgaccacgtgcgcaagactagagtggccatcaagaagatcagc
cccttcgagcaccaaacctactgccagcgcacactgagggagatccagatcttgctgcga
ttccgccatgagaatgtcataggcatccgagacatcctcagagcacccaccctggaagct
atgagggatgtttacatcgttcaggacctcatggagacagacctgtacaagctgctcaag
agccagcagctgagcaacgaccacatctgctacttcctctaccagatccttcggggcctc
aagtacatccactcagccaacgtgctccaccgggacctgaagccctccaacctgcttatc
aacaccacctgcgaccttaagatatgtgactttggcctggcccggattgctgaccctgag
cacgaccacactggctttctgacagagtatgtggccacacgctggtaccgagccccagag
atcatgcttaactccaagggctacaccaaatccatcgacatctggtctgtgggctgcatt
ctggctgagatgctctccaaccggcccatcttccccggcaagcactacctggaccagctc
aaccacattctaggtatcttgggctccccatcccaggaggaccttaactgtatcatcaac
atgaaggcccgaaactacctgcagtctctgccctctaaaaccaaggtggcgtgggccaag
cttttccccaaatccgactccaaagcacttgacctgctggaccggatgttaaccttcaac
cccaacaagcgcatcacggtggaggaagccctggctcacccgtacctggagcagtactat
gacccgacagacgagccggtggccgaggaacccttcacctttgacatggagctggatgac
ctccctaaggagcggctgaaggaactgatcttccaagagacagcccgcttccagccaggg
gctccagaggccccctaa

DBGET integrated database retrieval system