KEGG   Peromyscus leucopus (white-footed mouse): 114708768
Entry
114708768         CDS       T07241                                 
Name
(RefSeq) calmodulin-4-like
  KO
K02183  calmodulin
Organism
pleu  Peromyscus leucopus (white-footed mouse)
Pathway
pleu04014  Ras signaling pathway
pleu04015  Rap1 signaling pathway
pleu04020  Calcium signaling pathway
pleu04022  cGMP-PKG signaling pathway
pleu04024  cAMP signaling pathway
pleu04070  Phosphatidylinositol signaling system
pleu04114  Oocyte meiosis
pleu04218  Cellular senescence
pleu04261  Adrenergic signaling in cardiomyocytes
pleu04270  Vascular smooth muscle contraction
pleu04371  Apelin signaling pathway
pleu04625  C-type lectin receptor signaling pathway
pleu04713  Circadian entrainment
pleu04720  Long-term potentiation
pleu04722  Neurotrophin signaling pathway
pleu04728  Dopaminergic synapse
pleu04740  Olfactory transduction
pleu04744  Phototransduction
pleu04750  Inflammatory mediator regulation of TRP channels
pleu04910  Insulin signaling pathway
pleu04912  GnRH signaling pathway
pleu04915  Estrogen signaling pathway
pleu04916  Melanogenesis
pleu04921  Oxytocin signaling pathway
pleu04922  Glucagon signaling pathway
pleu04924  Renin secretion
pleu04925  Aldosterone synthesis and secretion
pleu04970  Salivary secretion
pleu04971  Gastric acid secretion
pleu05010  Alzheimer disease
pleu05012  Parkinson disease
pleu05022  Pathways of neurodegeneration - multiple diseases
pleu05031  Amphetamine addiction
pleu05034  Alcoholism
pleu05133  Pertussis
pleu05152  Tuberculosis
pleu05163  Human cytomegalovirus infection
pleu05167  Kaposi sarcoma-associated herpesvirus infection
pleu05170  Human immunodeficiency virus 1 infection
pleu05200  Pathways in cancer
pleu05214  Glioma
pleu05417  Lipid and atherosclerosis
pleu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pleu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    114708768
   04015 Rap1 signaling pathway
    114708768
   04371 Apelin signaling pathway
    114708768
   04020 Calcium signaling pathway
    114708768
   04070 Phosphatidylinositol signaling system
    114708768
   04024 cAMP signaling pathway
    114708768
   04022 cGMP-PKG signaling pathway
    114708768
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114708768
   04218 Cellular senescence
    114708768
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114708768
  09152 Endocrine system
   04910 Insulin signaling pathway
    114708768
   04922 Glucagon signaling pathway
    114708768
   04912 GnRH signaling pathway
    114708768
   04915 Estrogen signaling pathway
    114708768
   04921 Oxytocin signaling pathway
    114708768
   04916 Melanogenesis
    114708768
   04924 Renin secretion
    114708768
   04925 Aldosterone synthesis and secretion
    114708768
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114708768
   04270 Vascular smooth muscle contraction
    114708768
  09154 Digestive system
   04970 Salivary secretion
    114708768
   04971 Gastric acid secretion
    114708768
  09156 Nervous system
   04728 Dopaminergic synapse
    114708768
   04720 Long-term potentiation
    114708768
   04722 Neurotrophin signaling pathway
    114708768
  09157 Sensory system
   04744 Phototransduction
    114708768
   04740 Olfactory transduction
    114708768
   04750 Inflammatory mediator regulation of TRP channels
    114708768
  09159 Environmental adaptation
   04713 Circadian entrainment
    114708768
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114708768
  09162 Cancer: specific types
   05214 Glioma
    114708768
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114708768
   05163 Human cytomegalovirus infection
    114708768
   05167 Kaposi sarcoma-associated herpesvirus infection
    114708768
  09171 Infectious disease: bacterial
   05133 Pertussis
    114708768
   05152 Tuberculosis
    114708768
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114708768
   05012 Parkinson disease
    114708768
   05022 Pathways of neurodegeneration - multiple diseases
    114708768
  09165 Substance dependence
   05031 Amphetamine addiction
    114708768
   05034 Alcoholism
    114708768
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114708768
   05418 Fluid shear stress and atherosclerosis
    114708768
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pleu01009]
    114708768
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pleu04131]
    114708768
   03036 Chromosome and associated proteins [BR:pleu03036]
    114708768
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pleu04147]
    114708768
Protein phosphatases and associated proteins [BR:pleu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     114708768
Membrane trafficking [BR:pleu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    114708768
Chromosome and associated proteins [BR:pleu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     114708768
Exosome [BR:pleu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   114708768
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EF-hand_FSTL1 EH EF_EFCAB10_C SAPC2_N SPARC_Ca_bdg EF-hand_EFHB_C EF-hand_STIM1 DUF2267 DUF5580_M EF-hand_11 TerB UPF0154 p25-alpha WEF-hand Dockerin_1 DUF6079_2nd vRNAP_dom SurA_N_2 HGD-D DUF7827
Other DBs
NCBI-GeneID: 114708768
NCBI-ProteinID: XP_028748109
LinkDB
Position
5:complement(56824033..56824983)
AA seq 148 aa
MSHGFPKEQVDEFHAAFDRFDKNKDGHISVGELGDVMKQLGKNLSEEELKALISKVDTDQ
DGTISFDEFLAAMAKYKRGSTEQELRAVFSVFDQNGDGHITVEELKQAMDQLGEKLSQEE
LDAMIREADADQDGRVNYDEFVRIFLEK
NT seq 447 nt   +upstreamnt  +downstreamnt
atgtctcacgggtttcctaaggagcaggtggacgagttccatgcagcctttgatagattt
gacaagaacaaggacggccacatcagtgtcggggaactgggtgatgtgatgaagcagctg
ggtaagaacctctcagaggaagaactgaaggcgctcatctccaaggtggacacagaccaa
gatggcaccatcagctttgacgaattcttggcagccatggccaagtataagagagggagc
accgagcaggagctgcgggctgtgttcagtgtctttgaccagaatggtgatggccacatc
actgtggaggagctcaagcaggccatggatcagctgggagagaagctttcacaggaggag
ctggatgccatgatccgtgaggctgatgcggaccaggatgggagggtgaactatgatgag
tttgtgcgcatcttccttgagaagtga

DBGET integrated database retrieval system