Panthera leo (lion): 122198742 Help Entry 122198742         CDS       T10741                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism plez  Panthera leo (lion) Pathway plez04024   cAMP signaling pathway plez04080   Neuroactive ligand-receptor interaction plez04081   Hormone signaling plez04935   Growth hormone synthesis, secretion and action plez04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     122198742 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     122198742 (SST)    04081 Hormone signaling     122198742 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     122198742 (SST)   09154 Digestive system    04971 Gastric acid secretion     122198742 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122198742 (SST) Cytokines and neuropeptides [BR:plez04052]  Neuropeptides   GPCR binding    122198742 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  122198742 NCBI-ProteinID:  XP_042759426 UniProt:  A0A8C8Y5V2 LinkDB All DBs Position C2:79970864..79972332 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggctctgggc ggtgtcaccggcgcgccctccgatcctcgactccgtcagtttctgcagaagtccctggct gctgccgcggggaagcaggaactggccaagtacttcttggcggagctcctgtctgaaccc aaccagacagagaacgatgccctggaacccgaagacttgtcccaggcggctgagcaggat gaaatgaggctggaactgcagagatccactaactcaaaccctgccatggcaccccgagaa cgcaaagccggctgcaagaatttcttctggaagactttcacttcctgttag

DBGET integrated database retrieval system