Panthera leo (lion): 122200306 Help Entry 122200306         CDS       T10741                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism plez  Panthera leo (lion) Pathway plez04060   Cytokine-cytokine receptor interaction plez04630   JAK-STAT signaling pathway plez04640   Hematopoietic cell lineage plez04657   IL-17 signaling pathway plez04658   Th1 and Th2 cell differentiation plez04660   T cell receptor signaling pathway plez04664   Fc epsilon RI signaling pathway plez04672   Intestinal immune network for IgA production plez05200   Pathways in cancer plez05310   Asthma plez05320   Autoimmune thyroid disease plez05321   Inflammatory bowel disease plez05330   Allograft rejection Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122200306 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122200306 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     122200306 (IL5)    04660 T cell receptor signaling pathway     122200306 (IL5)    04658 Th1 and Th2 cell differentiation     122200306 (IL5)    04657 IL-17 signaling pathway     122200306 (IL5)    04664 Fc epsilon RI signaling pathway     122200306 (IL5)    04672 Intestinal immune network for IgA production     122200306 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122200306 (IL5)   09163 Immune disease    05310 Asthma     122200306 (IL5)    05320 Autoimmune thyroid disease     122200306 (IL5)    05321 Inflammatory bowel disease     122200306 (IL5)    05330 Allograft rejection     122200306 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122200306 (IL5)    00536 Glycosaminoglycan binding proteins [BR:plez00536]     122200306 (IL5) Cytokines and neuropeptides [BR:plez04052]  Cytokines   Interleukins    122200306 (IL5) Glycosaminoglycan binding proteins [BR:plez00536]  Heparan sulfate / Heparin   Cytokines    122200306 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  122200306 NCBI-ProteinID:  XP_042761785 UniProt:  A0A8C8WHZ1 LinkDB All DBs Position A1:complement(109401333..109402991) Genome browser AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSAIAVQSPMNRLVAETLALLSTHRTLLIGDGNLMIPTPEHNNH QLCIEEVFQGIDTLKNRTAPGDAVDKLFRNLSLIKEHIDLQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgccatt gctgtacaaagtcccatgaataggctggtggcagagaccttggcactgctctccactcat cgaactctactgataggcgacgggaacctgatgattcctactcctgaacataacaatcac caactgtgcattgaagaagtctttcagggtatagacacattaaagaatcgcactgcaccg ggggatgctgtggacaagcttttccgaaacttgtctttaataaaagaacacatagacctc caaaaaaaaaagtgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtaataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system