Panthera leo (lion): 122201259 Help Entry 122201259         CDS       T10741                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism plez  Panthera leo (lion) Pathway plez04015   Rap1 signaling pathway plez04810   Regulation of actin cytoskeleton plez05014   Amyotrophic lateral sclerosis plez05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122201259 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122201259 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122201259 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122201259 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plez04131]     122201259 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:plez04812]     122201259 (PFN3)    04147 Exosome [BR:plez04147]     122201259 (PFN3) Membrane trafficking [BR:plez04131]  Others   Actin-binding proteins    Others     122201259 (PFN3) Cytoskeleton proteins [BR:plez04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      122201259 (PFN3) Exosome [BR:plez04147]  Exosomal proteins   Proteins found in most exosomes    122201259 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  122201259 NCBI-ProteinID:  XP_042763100 UniProt:  A0A8C8XZH0 LinkDB All DBs Position A1:172758277..172759037 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIMGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKTVHELINGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggactggaaaggctatatcagtgcagtactgcgggaccagcgtattgatgacgtg gccatcatgggccactcggacaatcgctgcgtgtgggcatcgcgccctgggggccttcta gctgccatatcaccacaggaggtgggtgtgctcacagggcctgatcggcacaccttcctg caggccggcctgagtgtggcaggccgccgctgctgtgtcatccgagaccacctgctgtct gagggagatggtgttctggacgctcgcactaaagggctggatgggcgtgctgtctgcgtg ggccacaccccgcgcgcgctcctggtgctcatgggccgacggggtgtgcatgggggcatc ctcaacaagacagtgcatgagctgatcaatgggctacgcaagcagggcacatag

DBGET integrated database retrieval system