Panthera leo (lion): 122205007 Help Entry 122205007         CDS       T10741                                  Name (RefSeq) interferon alpha-like   KO K05414   interferon alpha Organism plez  Panthera leo (lion) Pathway plez04060   Cytokine-cytokine receptor interaction plez04151   PI3K-Akt signaling pathway plez04217   Necroptosis plez04620   Toll-like receptor signaling pathway plez04621   NOD-like receptor signaling pathway plez04622   RIG-I-like receptor signaling pathway plez04623   Cytosolic DNA-sensing pathway plez04630   JAK-STAT signaling pathway plez04650   Natural killer cell mediated cytotoxicity plez04936   Alcoholic liver disease plez05152   Tuberculosis plez05160   Hepatitis C plez05161   Hepatitis B plez05162   Measles plez05163   Human cytomegalovirus infection plez05164   Influenza A plez05165   Human papillomavirus infection plez05167   Kaposi sarcoma-associated herpesvirus infection plez05168   Herpes simplex virus 1 infection plez05169   Epstein-Barr virus infection plez05170   Human immunodeficiency virus 1 infection plez05171   Coronavirus disease - COVID-19 plez05200   Pathways in cancer plez05320   Autoimmune thyroid disease plez05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122205007    04151 PI3K-Akt signaling pathway     122205007   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122205007  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122205007  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122205007    04621 NOD-like receptor signaling pathway     122205007    04622 RIG-I-like receptor signaling pathway     122205007    04623 Cytosolic DNA-sensing pathway     122205007    04650 Natural killer cell mediated cytotoxicity     122205007  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122205007   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122205007    05161 Hepatitis B     122205007    05160 Hepatitis C     122205007    05171 Coronavirus disease - COVID-19     122205007    05164 Influenza A     122205007    05162 Measles     122205007    05168 Herpes simplex virus 1 infection     122205007    05163 Human cytomegalovirus infection     122205007    05167 Kaposi sarcoma-associated herpesvirus infection     122205007    05169 Epstein-Barr virus infection     122205007    05165 Human papillomavirus infection     122205007   09171 Infectious disease: bacterial    05152 Tuberculosis     122205007   09163 Immune disease    05320 Autoimmune thyroid disease     122205007   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122205007   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122205007  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122205007 Cytokines and neuropeptides [BR:plez04052]  Cytokines   Interferons    122205007 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  122205007 NCBI-ProteinID:  XP_042768878 LinkDB All DBs Position D4:complement(45549099..45549668) Genome browser AA seq 189 aa AA seqDB search MALPSSFLVALVALGCNSVCSLGCDLPHTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCMGLDRQLTRL EACVMQEVGEGEAPLTNQDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSSIA LQKRLRSEK NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc tctctgggctgtgacctgcctcacacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgccagaaggacagaaatgacttcgcc ttcccccaggacgtgtttggtggagaccagtcccacaaggcccaagccctctctgtggtg cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattctgcatgggacttgatcggcagctgacccgcctg gaagcctgtgtcatgcaggaggtgggggagggagaggctcccctcaccaaccaggactcc atcctgaggaactacttccaaagactctccctctacctgcaagagaagaaatacagccct tgtgcctgggagatcgtcagagcagaaatcatgaggtccttgtattattcatcaatagcc ttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system