Panthera leo (lion): 122206012 Help Entry 122206012         CDS       T10741                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism plez  Panthera leo (lion) Pathway plez04081   Hormone signaling plez04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     122206012 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     122206012 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122206012 (GAST) Cytokines and neuropeptides [BR:plez04052]  Neuropeptides   GPCR binding    122206012 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  122206012 NCBI-ProteinID:  XP_042770667 LinkDB All DBs Position E1:40168991..40169427 Genome browser AA seq 104 aa AA seqDB search MQRLCVCVLILALALTAVSEASWKPRSQLQDTPSGPGANRGLEPHWLNRLGPASHHRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgtgtgtgcgtgctgatcttggcactggctctgaccgccgtctctgaa gcttcctggaagccccgctcccagctgcaggatacaccctcgggtccaggggccaacagg ggcctggaaccacattggctgaaccggctgggcccagcctctcaccaccgacggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcatacggatggatggacttcggccgccgcagtgcagaggacggg gaccaacatccctag

DBGET integrated database retrieval system