Panthera leo (lion): 122206834 Help Entry 122206834         CDS       T10741                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism plez  Panthera leo (lion) Pathway plez04060   Cytokine-cytokine receptor interaction plez04061   Viral protein interaction with cytokine and cytokine receptor plez04062   Chemokine signaling pathway plez04620   Toll-like receptor signaling pathway plez05142   Chagas disease plez05163   Human cytomegalovirus infection plez05323   Rheumatoid arthritis plez05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122206834    04061 Viral protein interaction with cytokine and cytokine receptor     122206834  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122206834    04062 Chemokine signaling pathway     122206834  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     122206834   09174 Infectious disease: parasitic    05142 Chagas disease     122206834   09163 Immune disease    05323 Rheumatoid arthritis     122206834   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122206834  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122206834    00536 Glycosaminoglycan binding proteins [BR:plez00536]     122206834 Cytokines and neuropeptides [BR:plez04052]  Cytokines   Chemokines    122206834 Glycosaminoglycan binding proteins [BR:plez00536]  Heparan sulfate / Heparin   Chemokines    122206834 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  122206834 NCBI-ProteinID:  XP_042772346 UniProt:  A0A8C9DBW9 LinkDB All DBs Position E1:complement(23106388..23108271) Genome browser AA seq 93 aa AA seqDB search MKVPGAALAILLCTMALCSQVFSAPFGADTPTACCFSYVSKQIPRKFIADYFETSSQCSK PGVIFQTRRGRQVCADPSEAWVQEYVTDLELSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccctggggctgccctcgccatcctcctctgcaccatggccctctgcagtcag gtcttctctgcaccatttggtgctgacaccccaactgcctgctgcttctcctatgtctcc aagcagattccacgcaagttcatagccgactactttgagaccagcagccaatgctccaag ccaggggttatctttcaaaccagaagaggccggcaggtctgtgctgaccccagtgaagcc tgggtccaggaatatgtgactgacttggagctgagtgcctga

DBGET integrated database retrieval system