Panthera leo (lion): 122208739 Help Entry 122208739         CDS       T10741                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism plez  Panthera leo (lion) Pathway plez04010   MAPK signaling pathway plez04014   Ras signaling pathway plez04015   Rap1 signaling pathway plez04024   cAMP signaling pathway plez04072   Phospholipase D signaling pathway plez04137   Mitophagy - animal plez04140   Autophagy - animal plez04218   Cellular senescence plez04360   Axon guidance plez04371   Apelin signaling pathway plez04519   Cadherin signaling plez04625   C-type lectin receptor signaling pathway plez04810   Regulation of actin cytoskeleton plez05132   Salmonella infection plez05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122208739 (RRAS)    04014 Ras signaling pathway     122208739 (RRAS)    04015 Rap1 signaling pathway     122208739 (RRAS)    04371 Apelin signaling pathway     122208739 (RRAS)    04072 Phospholipase D signaling pathway     122208739 (RRAS)    04024 cAMP signaling pathway     122208739 (RRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     122208739 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122208739 (RRAS)    04137 Mitophagy - animal     122208739 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     122208739 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122208739 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122208739 (RRAS)   09158 Development and regeneration    04360 Axon guidance     122208739 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     122208739 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     122208739 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:plez04031]     122208739 (RRAS) GTP-binding proteins [BR:plez04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122208739 (RRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  122208739 NCBI-ProteinID:  XP_042776098 UniProt:  A0A8C8WWF3 LinkDB All DBs Position E2:8388893..8392824 Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAYGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggactgggcgggggcggccccggggcggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcactgaccatccagttcatccagtcctactttgtgtctgactatgaccca accatcgaagactcctatacgaagatctgcactgtggatggtgtcccggcccggctggac atcctggacactgcaggccaggaggagttcggtgccatgcgggagcagtacatgcgcgct ggccacggcttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtaggc aagcttttcacgcagatcctccgagtgaaggaccgagacgacttccccatcgtgttggtt gggaacaaggcagatctggagacacagcgccaggtcccccgatctgaagcctctgcctat ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgcctcaatgtggac gaggccttcgagcagctggtgcgggccgtacggaagtatcaggaacaagagctcccgccc agcccacccagcgcccccaggaagaaggacgggggctgtccctgtgtcctcctgtag

DBGET integrated database retrieval system