KEGG   Panthera leo (lion): 122209715
Entry
122209715         CDS       T10741                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
plez  Panthera leo (lion)
Pathway
plez01521  EGFR tyrosine kinase inhibitor resistance
plez01522  Endocrine resistance
plez01524  Platinum drug resistance
plez04010  MAPK signaling pathway
plez04012  ErbB signaling pathway
plez04014  Ras signaling pathway
plez04015  Rap1 signaling pathway
plez04022  cGMP-PKG signaling pathway
plez04024  cAMP signaling pathway
plez04062  Chemokine signaling pathway
plez04066  HIF-1 signaling pathway
plez04068  FoxO signaling pathway
plez04071  Sphingolipid signaling pathway
plez04072  Phospholipase D signaling pathway
plez04114  Oocyte meiosis
plez04140  Autophagy - animal
plez04148  Efferocytosis
plez04150  mTOR signaling pathway
plez04151  PI3K-Akt signaling pathway
plez04210  Apoptosis
plez04218  Cellular senescence
plez04261  Adrenergic signaling in cardiomyocytes
plez04270  Vascular smooth muscle contraction
plez04350  TGF-beta signaling pathway
plez04360  Axon guidance
plez04370  VEGF signaling pathway
plez04371  Apelin signaling pathway
plez04380  Osteoclast differentiation
plez04510  Focal adhesion
plez04517  IgSF CAM signaling
plez04520  Adherens junction
plez04540  Gap junction
plez04550  Signaling pathways regulating pluripotency of stem cells
plez04611  Platelet activation
plez04613  Neutrophil extracellular trap formation
plez04620  Toll-like receptor signaling pathway
plez04621  NOD-like receptor signaling pathway
plez04625  C-type lectin receptor signaling pathway
plez04650  Natural killer cell mediated cytotoxicity
plez04657  IL-17 signaling pathway
plez04658  Th1 and Th2 cell differentiation
plez04659  Th17 cell differentiation
plez04660  T cell receptor signaling pathway
plez04662  B cell receptor signaling pathway
plez04664  Fc epsilon RI signaling pathway
plez04666  Fc gamma R-mediated phagocytosis
plez04668  TNF signaling pathway
plez04713  Circadian entrainment
plez04720  Long-term potentiation
plez04722  Neurotrophin signaling pathway
plez04723  Retrograde endocannabinoid signaling
plez04724  Glutamatergic synapse
plez04725  Cholinergic synapse
plez04726  Serotonergic synapse
plez04730  Long-term depression
plez04810  Regulation of actin cytoskeleton
plez04910  Insulin signaling pathway
plez04912  GnRH signaling pathway
plez04914  Progesterone-mediated oocyte maturation
plez04915  Estrogen signaling pathway
plez04916  Melanogenesis
plez04917  Prolactin signaling pathway
plez04919  Thyroid hormone signaling pathway
plez04921  Oxytocin signaling pathway
plez04926  Relaxin signaling pathway
plez04928  Parathyroid hormone synthesis, secretion and action
plez04929  GnRH secretion
plez04930  Type II diabetes mellitus
plez04933  AGE-RAGE signaling pathway in diabetic complications
plez04934  Cushing syndrome
plez04935  Growth hormone synthesis, secretion and action
plez04960  Aldosterone-regulated sodium reabsorption
plez05010  Alzheimer disease
plez05020  Prion disease
plez05022  Pathways of neurodegeneration - multiple diseases
plez05034  Alcoholism
plez05132  Salmonella infection
plez05133  Pertussis
plez05135  Yersinia infection
plez05140  Leishmaniasis
plez05142  Chagas disease
plez05145  Toxoplasmosis
plez05152  Tuberculosis
plez05160  Hepatitis C
plez05161  Hepatitis B
plez05163  Human cytomegalovirus infection
plez05164  Influenza A
plez05165  Human papillomavirus infection
plez05166  Human T-cell leukemia virus 1 infection
plez05167  Kaposi sarcoma-associated herpesvirus infection
plez05170  Human immunodeficiency virus 1 infection
plez05171  Coronavirus disease - COVID-19
plez05200  Pathways in cancer
plez05203  Viral carcinogenesis
plez05205  Proteoglycans in cancer
plez05206  MicroRNAs in cancer
plez05207  Chemical carcinogenesis - receptor activation
plez05208  Chemical carcinogenesis - reactive oxygen species
plez05210  Colorectal cancer
plez05211  Renal cell carcinoma
plez05212  Pancreatic cancer
plez05213  Endometrial cancer
plez05214  Glioma
plez05215  Prostate cancer
plez05216  Thyroid cancer
plez05218  Melanoma
plez05219  Bladder cancer
plez05220  Chronic myeloid leukemia
plez05221  Acute myeloid leukemia
plez05223  Non-small cell lung cancer
plez05224  Breast cancer
plez05225  Hepatocellular carcinoma
plez05226  Gastric cancer
plez05230  Central carbon metabolism in cancer
plez05231  Choline metabolism in cancer
plez05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
plez05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:plez00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122209715 (MAPK3)
   04012 ErbB signaling pathway
    122209715 (MAPK3)
   04014 Ras signaling pathway
    122209715 (MAPK3)
   04015 Rap1 signaling pathway
    122209715 (MAPK3)
   04350 TGF-beta signaling pathway
    122209715 (MAPK3)
   04370 VEGF signaling pathway
    122209715 (MAPK3)
   04371 Apelin signaling pathway
    122209715 (MAPK3)
   04668 TNF signaling pathway
    122209715 (MAPK3)
   04066 HIF-1 signaling pathway
    122209715 (MAPK3)
   04068 FoxO signaling pathway
    122209715 (MAPK3)
   04072 Phospholipase D signaling pathway
    122209715 (MAPK3)
   04071 Sphingolipid signaling pathway
    122209715 (MAPK3)
   04024 cAMP signaling pathway
    122209715 (MAPK3)
   04022 cGMP-PKG signaling pathway
    122209715 (MAPK3)
   04151 PI3K-Akt signaling pathway
    122209715 (MAPK3)
   04150 mTOR signaling pathway
    122209715 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    122209715 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    122209715 (MAPK3)
   04148 Efferocytosis
    122209715 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    122209715 (MAPK3)
   04210 Apoptosis
    122209715 (MAPK3)
   04218 Cellular senescence
    122209715 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    122209715 (MAPK3)
   04520 Adherens junction
    122209715 (MAPK3)
   04540 Gap junction
    122209715 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    122209715 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122209715 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    122209715 (MAPK3)
   04613 Neutrophil extracellular trap formation
    122209715 (MAPK3)
   04620 Toll-like receptor signaling pathway
    122209715 (MAPK3)
   04621 NOD-like receptor signaling pathway
    122209715 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    122209715 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    122209715 (MAPK3)
   04660 T cell receptor signaling pathway
    122209715 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    122209715 (MAPK3)
   04659 Th17 cell differentiation
    122209715 (MAPK3)
   04657 IL-17 signaling pathway
    122209715 (MAPK3)
   04662 B cell receptor signaling pathway
    122209715 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    122209715 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    122209715 (MAPK3)
   04062 Chemokine signaling pathway
    122209715 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    122209715 (MAPK3)
   04929 GnRH secretion
    122209715 (MAPK3)
   04912 GnRH signaling pathway
    122209715 (MAPK3)
   04915 Estrogen signaling pathway
    122209715 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    122209715 (MAPK3)
   04917 Prolactin signaling pathway
    122209715 (MAPK3)
   04921 Oxytocin signaling pathway
    122209715 (MAPK3)
   04926 Relaxin signaling pathway
    122209715 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    122209715 (MAPK3)
   04919 Thyroid hormone signaling pathway
    122209715 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    122209715 (MAPK3)
   04916 Melanogenesis
    122209715 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    122209715 (MAPK3)
   04270 Vascular smooth muscle contraction
    122209715 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    122209715 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    122209715 (MAPK3)
   04725 Cholinergic synapse
    122209715 (MAPK3)
   04726 Serotonergic synapse
    122209715 (MAPK3)
   04720 Long-term potentiation
    122209715 (MAPK3)
   04730 Long-term depression
    122209715 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    122209715 (MAPK3)
   04722 Neurotrophin signaling pathway
    122209715 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    122209715 (MAPK3)
   04380 Osteoclast differentiation
    122209715 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    122209715 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122209715 (MAPK3)
   05206 MicroRNAs in cancer
    122209715 (MAPK3)
   05205 Proteoglycans in cancer
    122209715 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    122209715 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    122209715 (MAPK3)
   05203 Viral carcinogenesis
    122209715 (MAPK3)
   05230 Central carbon metabolism in cancer
    122209715 (MAPK3)
   05231 Choline metabolism in cancer
    122209715 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122209715 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    122209715 (MAPK3)
   05212 Pancreatic cancer
    122209715 (MAPK3)
   05225 Hepatocellular carcinoma
    122209715 (MAPK3)
   05226 Gastric cancer
    122209715 (MAPK3)
   05214 Glioma
    122209715 (MAPK3)
   05216 Thyroid cancer
    122209715 (MAPK3)
   05221 Acute myeloid leukemia
    122209715 (MAPK3)
   05220 Chronic myeloid leukemia
    122209715 (MAPK3)
   05218 Melanoma
    122209715 (MAPK3)
   05211 Renal cell carcinoma
    122209715 (MAPK3)
   05219 Bladder cancer
    122209715 (MAPK3)
   05215 Prostate cancer
    122209715 (MAPK3)
   05213 Endometrial cancer
    122209715 (MAPK3)
   05224 Breast cancer
    122209715 (MAPK3)
   05223 Non-small cell lung cancer
    122209715 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122209715 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    122209715 (MAPK3)
   05161 Hepatitis B
    122209715 (MAPK3)
   05160 Hepatitis C
    122209715 (MAPK3)
   05171 Coronavirus disease - COVID-19
    122209715 (MAPK3)
   05164 Influenza A
    122209715 (MAPK3)
   05163 Human cytomegalovirus infection
    122209715 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    122209715 (MAPK3)
   05165 Human papillomavirus infection
    122209715 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    122209715 (MAPK3)
   05135 Yersinia infection
    122209715 (MAPK3)
   05133 Pertussis
    122209715 (MAPK3)
   05152 Tuberculosis
    122209715 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    122209715 (MAPK3)
   05140 Leishmaniasis
    122209715 (MAPK3)
   05142 Chagas disease
    122209715 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122209715 (MAPK3)
   05020 Prion disease
    122209715 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    122209715 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    122209715 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122209715 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    122209715 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    122209715 (MAPK3)
   04934 Cushing syndrome
    122209715 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122209715 (MAPK3)
   01524 Platinum drug resistance
    122209715 (MAPK3)
   01522 Endocrine resistance
    122209715 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:plez01001]
    122209715 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:plez03036]
    122209715 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:plez04147]
    122209715 (MAPK3)
Enzymes [BR:plez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     122209715 (MAPK3)
Protein kinases [BR:plez01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   122209715 (MAPK3)
Chromosome and associated proteins [BR:plez03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     122209715 (MAPK3)
Exosome [BR:plez04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   122209715 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 122209715
NCBI-ProteinID: XP_042777770
LinkDB
Position
E3:complement(18330997..18337209)
AA seq 410 aa
MAAAAAQGGGGGEPGGADGVGPGVSGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
AKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEVGQPPATGLVGRWMGRRPSVP
GLSLTSLLPQPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGALEAP
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagcccgggggagctgatggggtc
ggcccgggggtctcgggggaggtggaggtagtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagcttat
gaccacgtgcgcaagactcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacgctgcgggagatccagatcctgcttcgcttccgccatgagaacgtc
attggcatccgggacattctgcgggcgcccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaac
gaccacatttgctacttcctctaccagatcctgcggggcctcaagtatatccactcagcc
aacgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgtgattttggcctggcccggattgccgatcctgagcatgaccacactggcttc
ctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaactccaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aacaggcccatcttccctggcaagcactacctggaccagctcaaccacattctggggatc
ctgggctccccatcccaggaggacttgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaagtcagat
gccaaagccctggatctgctagaccggatgttgacctttaaccccaacaaacggatcaca
gtggaggaagcactggctcacccctacctggagcagtactacgacccaacggatgaggtg
ggccagccaccagcaacagggctggtgggtagatggatgggtaggcgaccctcagtgccc
ggcctgagcctgacttctttactaccccagccagtggccgaggagcctttcaccttcgac
atggagctggatgatctacccaaggagcggctgaaggagctcatcttccaggagacagcc
cgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system