Panthera leo (lion): 122213418 Help Entry 122213418         CDS       T10741                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism plez  Panthera leo (lion) Pathway plez04144   Endocytosis plez04510   Focal adhesion plez05020   Prion disease plez05100   Bacterial invasion of epithelial cells plez05205   Proteoglycans in cancer plez05410   Hypertrophic cardiomyopathy plez05412   Arrhythmogenic right ventricular cardiomyopathy plez05414   Dilated cardiomyopathy plez05416   Viral myocarditis plez05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122213418 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     122213418 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     122213418 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122213418 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     122213418 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     122213418 (CAV3)    05410 Hypertrophic cardiomyopathy     122213418 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     122213418 (CAV3)    05414 Dilated cardiomyopathy     122213418 (CAV3)    05416 Viral myocarditis     122213418 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plez04131]     122213418 (CAV3) Membrane trafficking [BR:plez04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     122213418 (CAV3) SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  122213418 NCBI-ProteinID:  XP_042783475 LinkDB All DBs Position A2:50136855..50149984 Genome browser AA seq 151 aa AA seqDB search MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDRVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQICSNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaagaacacacagacctggaggcccagattgtcaaggacatccactgcaag gagatcgacctggtgaaccgagaccccaagaacattaacgaggacatagtgaaggtggat tttgaagacgtgatcgcagagcctgtgggcacctacagcttcgacagagtgtggaaggtg agctacaccaccttcactgtctccaagtactggtgctaccgcctgctgtccacgctgctg ggagtcccgctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccgtgcatcaagagctacctgatcgagatccagtgcatcagccacatc tactccctctgcatccgtaccttctgcaacccgctctttgccgccctgggccagatctgc agcaacatcaaggtgatgctgcggaaggaagtgtga

DBGET integrated database retrieval system