Panthera leo (lion): 122214341 Help Entry 122214341         CDS       T10741                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism plez  Panthera leo (lion) Pathway plez04014   Ras signaling pathway plez04015   Rap1 signaling pathway plez04022   cGMP-PKG signaling pathway plez04024   cAMP signaling pathway plez04062   Chemokine signaling pathway plez04071   Sphingolipid signaling pathway plez04072   Phospholipase D signaling pathway plez04081   Hormone signaling plez04144   Endocytosis plez04150   mTOR signaling pathway plez04270   Vascular smooth muscle contraction plez04310   Wnt signaling pathway plez04350   TGF-beta signaling pathway plez04360   Axon guidance plez04510   Focal adhesion plez04520   Adherens junction plez04530   Tight junction plez04611   Platelet activation plez04621   NOD-like receptor signaling pathway plez04625   C-type lectin receptor signaling pathway plez04660   T cell receptor signaling pathway plez04670   Leukocyte transendothelial migration plez04722   Neurotrophin signaling pathway plez04810   Regulation of actin cytoskeleton plez04921   Oxytocin signaling pathway plez04928   Parathyroid hormone synthesis, secretion and action plez04972   Pancreatic secretion plez05100   Bacterial invasion of epithelial cells plez05132   Salmonella infection plez05133   Pertussis plez05135   Yersinia infection plez05152   Tuberculosis plez05163   Human cytomegalovirus infection plez05200   Pathways in cancer plez05203   Viral carcinogenesis plez05205   Proteoglycans in cancer plez05206   MicroRNAs in cancer plez05210   Colorectal cancer plez05417   Lipid and atherosclerosis plez05418   Fluid shear stress and atherosclerosis Brite Membrane trafficking [BR:plez04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     122214341 (RHOA) Exosome [BR:plez04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122214341 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    122214341 (RHOA)   Exosomal proteins of colorectal cancer cells    122214341 (RHOA)   Exosomal proteins of bladder cancer cells    122214341 (RHOA) GTP-binding proteins [BR:plez04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     122214341 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  122214341 NCBI-ProteinID:  XP_042785291 LinkDB All DBs Position A2:complement(18258767..18322184) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacaccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccagtgaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system