Panthera leo (lion): 122215096 Help Entry 122215096         CDS       T10741                                  Symbol MTLN Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism plez  Panthera leo (lion) Brite KEGG Orthology (KO) [BR:plez00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:plez03029]     122215096 (MTLN) Mitochondrial biogenesis [BR:plez03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     122215096 (MTLN) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom CheW_CheR_link Motif Other DBs NCBI-GeneID:  122215096 NCBI-ProteinID:  XP_042786195 UniProt:  A0A8C8YF09 LinkDB All DBs Position A3:104048220..104049204 Genome browser AA seq 56 aa AA seqDB search MANVSERTLQLSVLVAFASGVLVGWQANRLRRRYLDWRKRRLQDKLAVTQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcgaacgtgtccgagcggacgctgcagttgtctgtgctggtggccttcgcgtctgga gtgctcgtgggctggcaggcgaaccggctgcggaggcgctacctggactggaggaagcgg aggctgcaggacaagctggcggtgactcagaagaagctggacttggcctga

DBGET integrated database retrieval system