Panthera leo (lion): 122215688 Help Entry 122215688         CDS       T10741                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism plez  Panthera leo (lion) Pathway plez01521   EGFR tyrosine kinase inhibitor resistance plez01524   Platinum drug resistance plez04014   Ras signaling pathway plez04064   NF-kappa B signaling pathway plez04115   p53 signaling pathway plez04137   Mitophagy - animal plez04140   Autophagy - animal plez04151   PI3K-Akt signaling pathway plez04210   Apoptosis plez04215   Apoptosis - multiple species plez04621   NOD-like receptor signaling pathway plez04630   JAK-STAT signaling pathway plez05012   Parkinson disease plez05014   Amyotrophic lateral sclerosis plez05022   Pathways of neurodegeneration - multiple diseases plez05145   Toxoplasmosis plez05162   Measles plez05166   Human T-cell leukemia virus 1 infection plez05168   Herpes simplex virus 1 infection plez05170   Human immunodeficiency virus 1 infection plez05200   Pathways in cancer plez05202   Transcriptional misregulation in cancer plez05212   Pancreatic cancer plez05220   Chronic myeloid leukemia plez05222   Small cell lung cancer plez05225   Hepatocellular carcinoma plez05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122215688 (BCL2L1)    04630 JAK-STAT signaling pathway     122215688 (BCL2L1)    04064 NF-kappa B signaling pathway     122215688 (BCL2L1)    04151 PI3K-Akt signaling pathway     122215688 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122215688 (BCL2L1)    04137 Mitophagy - animal     122215688 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     122215688 (BCL2L1)    04215 Apoptosis - multiple species     122215688 (BCL2L1)    04115 p53 signaling pathway     122215688 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     122215688 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122215688 (BCL2L1)    05202 Transcriptional misregulation in cancer     122215688 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     122215688 (BCL2L1)    05225 Hepatocellular carcinoma     122215688 (BCL2L1)    05220 Chronic myeloid leukemia     122215688 (BCL2L1)    05222 Small cell lung cancer     122215688 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122215688 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     122215688 (BCL2L1)    05162 Measles     122215688 (BCL2L1)    05168 Herpes simplex virus 1 infection     122215688 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     122215688 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     122215688 (BCL2L1)    05014 Amyotrophic lateral sclerosis     122215688 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     122215688 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122215688 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     122215688 (BCL2L1)    01524 Platinum drug resistance     122215688 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:plez01009]     122215688 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:plez03036]     122215688 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:plez02000]     122215688 (BCL2L1) Protein phosphatases and associated proteins [BR:plez01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      122215688 (BCL2L1) Chromosome and associated proteins [BR:plez03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     122215688 (BCL2L1) Transporters [BR:plez02000]  Other transporters   Pores ion channels [TC:1]    122215688 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  122215688 NCBI-ProteinID:  XP_042787252 LinkDB All DBs Position A3:26929567..26979145 Genome browser AA seq 290 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWKQKRTDPLAASHRCPGTLPNQATSTISYSIDDSVQRPPLPGCIINMRLLPCQ LHCQPRPSPAPIVESVRRGKITIGLNNSLLSSVALCNAMHTESSVSPAVK NT seq 873 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctggaagcagaagaggacagacccactggctgcatcccac agatgccctggaactctgccaaaccaggccacttccaccatcagctattcaattgatgac tcggtccagaggcctccactcccaggctgcatcatcaatatgcgccttctcccttgccaa ctgcactgccaacccagaccctctcctgcgccaatagtggaaagtgtcaggaggggaaag atcaccataggcttgaacaatagccttctcagcagtgtggctttgtgcaatgcaatgcac actgaatcctcagtttccccagctgtaaagtga

DBGET integrated database retrieval system