Panthera leo (lion): 122216562 Help Entry 122216562         CDS       T10741                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism plez  Panthera leo (lion) Pathway plez04015   Rap1 signaling pathway plez04810   Regulation of actin cytoskeleton plez05014   Amyotrophic lateral sclerosis plez05132   Salmonella infection Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122216562 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122216562 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122216562 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122216562 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plez04131]     122216562 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:plez04812]     122216562 (PFN4)    04147 Exosome [BR:plez04147]     122216562 (PFN4) Membrane trafficking [BR:plez04131]  Others   Actin-binding proteins    Others     122216562 (PFN4) Cytoskeleton proteins [BR:plez04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      122216562 (PFN4) Exosome [BR:plez04147]  Exosomal proteins   Proteins found in most exosomes    122216562 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  122216562 NCBI-ProteinID:  XP_042789496 UniProt:  A0A8C9CVW8 LinkDB All DBs Position A3:120803097..120810495 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaactcttgtgaatggatttgccaagaaccctttgcaaaccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system