Panthera leo (lion): 122216964 Help Entry 122216964         CDS       T10741                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism plez  Panthera leo (lion) Pathway plez04014   Ras signaling pathway plez04015   Rap1 signaling pathway plez04020   Calcium signaling pathway plez04022   cGMP-PKG signaling pathway plez04024   cAMP signaling pathway plez04070   Phosphatidylinositol signaling system plez04114   Oocyte meiosis plez04218   Cellular senescence plez04261   Adrenergic signaling in cardiomyocytes plez04270   Vascular smooth muscle contraction plez04371   Apelin signaling pathway plez04625   C-type lectin receptor signaling pathway plez04713   Circadian entrainment plez04720   Long-term potentiation plez04722   Neurotrophin signaling pathway plez04728   Dopaminergic synapse plez04740   Olfactory transduction plez04744   Phototransduction plez04750   Inflammatory mediator regulation of TRP channels plez04910   Insulin signaling pathway plez04912   GnRH signaling pathway plez04915   Estrogen signaling pathway plez04916   Melanogenesis plez04921   Oxytocin signaling pathway plez04922   Glucagon signaling pathway plez04924   Renin secretion plez04925   Aldosterone synthesis and secretion plez04970   Salivary secretion plez04971   Gastric acid secretion plez05010   Alzheimer disease plez05012   Parkinson disease plez05022   Pathways of neurodegeneration - multiple diseases plez05031   Amphetamine addiction plez05034   Alcoholism plez05133   Pertussis plez05152   Tuberculosis plez05163   Human cytomegalovirus infection plez05167   Kaposi sarcoma-associated herpesvirus infection plez05170   Human immunodeficiency virus 1 infection plez05200   Pathways in cancer plez05214   Glioma plez05417   Lipid and atherosclerosis plez05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122216964    04015 Rap1 signaling pathway     122216964    04371 Apelin signaling pathway     122216964    04020 Calcium signaling pathway     122216964    04070 Phosphatidylinositol signaling system     122216964    04024 cAMP signaling pathway     122216964    04022 cGMP-PKG signaling pathway     122216964  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     122216964    04218 Cellular senescence     122216964  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122216964   09152 Endocrine system    04910 Insulin signaling pathway     122216964    04922 Glucagon signaling pathway     122216964    04912 GnRH signaling pathway     122216964    04915 Estrogen signaling pathway     122216964    04921 Oxytocin signaling pathway     122216964    04916 Melanogenesis     122216964    04924 Renin secretion     122216964    04925 Aldosterone synthesis and secretion     122216964   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     122216964    04270 Vascular smooth muscle contraction     122216964   09154 Digestive system    04970 Salivary secretion     122216964    04971 Gastric acid secretion     122216964   09156 Nervous system    04728 Dopaminergic synapse     122216964    04720 Long-term potentiation     122216964    04722 Neurotrophin signaling pathway     122216964   09157 Sensory system    04744 Phototransduction     122216964    04740 Olfactory transduction     122216964    04750 Inflammatory mediator regulation of TRP channels     122216964   09159 Environmental adaptation    04713 Circadian entrainment     122216964  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122216964   09162 Cancer: specific types    05214 Glioma     122216964   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122216964    05163 Human cytomegalovirus infection     122216964    05167 Kaposi sarcoma-associated herpesvirus infection     122216964   09171 Infectious disease: bacterial    05133 Pertussis     122216964    05152 Tuberculosis     122216964   09164 Neurodegenerative disease    05010 Alzheimer disease     122216964    05012 Parkinson disease     122216964    05022 Pathways of neurodegeneration - multiple diseases     122216964   09165 Substance dependence    05031 Amphetamine addiction     122216964    05034 Alcoholism     122216964   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122216964    05418 Fluid shear stress and atherosclerosis     122216964  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:plez01009]     122216964   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:plez04131]     122216964    03036 Chromosome and associated proteins [BR:plez03036]     122216964   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plez04147]     122216964 Protein phosphatases and associated proteins [BR:plez01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122216964 Membrane trafficking [BR:plez04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122216964 Chromosome and associated proteins [BR:plez03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122216964 Exosome [BR:plez04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122216964 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 CFAP251_C AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_EFHB_C SAPC2_N EF-hand_11 Dockerin_1 Poly_export EF-hand_STIM1 TFIIS_M DUF5580_M Motif Other DBs NCBI-GeneID:  122216964 NCBI-ProteinID:  XP_042789846 UniProt:  A0A8C8X1P1 LinkDB All DBs Position B1:complement(75970353..75970784) Genome browser AA seq 143 aa AA seqDB search MADQLTEDQIAELKEAFSLFDKDGGGAVRTRKFGTVVRSLGQNPTEDELQDMINKVDADN DGTIEFPEFLTMTARKMKESDSKEEIQKAFRVFDKDINGHISAAELCHVMTNLGEKLTDE EVGEMIREADIDGDGQVNYEEFV NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggctgatcagctgacagaagaccagattgctgagctcaaggaagctttctctctattt gacaaagatggtggtggcgctgtcagaacaaggaaatttggaactgtcgtgaggtcactg ggtcagaacccaacagaagacgaattgcaggatatgatcaacaaggtagatgcggacaat gatggcaccattgagttcccagagtttttgactatgacagctagaaaaatgaaagaatca gatagtaaagaagaaattcagaaggcattccgagtctttgacaaggatatcaatggtcac atcagtgcggcagaactatgtcatgtcatgacaaacttaggagaaaaactaacagatgaa gaagtaggtgaaatgatcagggaagcagatattgatggagatggacaagtcaactatgaa gaatttgtgtag

DBGET integrated database retrieval system