Panthera leo (lion): 122217892 Help Entry 122217892         CDS       T10741                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism plez  Panthera leo (lion) Pathway plez04060   Cytokine-cytokine receptor interaction plez04061   Viral protein interaction with cytokine and cytokine receptor plez04151   PI3K-Akt signaling pathway plez04625   C-type lectin receptor signaling pathway plez04630   JAK-STAT signaling pathway plez04658   Th1 and Th2 cell differentiation plez04659   Th17 cell differentiation plez04660   T cell receptor signaling pathway plez04672   Intestinal immune network for IgA production plez04940   Type I diabetes mellitus plez05135   Yersinia infection plez05142   Chagas disease plez05162   Measles plez05166   Human T-cell leukemia virus 1 infection plez05171   Coronavirus disease - COVID-19 plez05200   Pathways in cancer plez05320   Autoimmune thyroid disease plez05321   Inflammatory bowel disease plez05330   Allograft rejection plez05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122217892 (IL2)    04151 PI3K-Akt signaling pathway     122217892 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122217892 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     122217892 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122217892 (IL2)    04660 T cell receptor signaling pathway     122217892 (IL2)    04658 Th1 and Th2 cell differentiation     122217892 (IL2)    04659 Th17 cell differentiation     122217892 (IL2)    04672 Intestinal immune network for IgA production     122217892 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122217892 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122217892 (IL2)    05171 Coronavirus disease - COVID-19     122217892 (IL2)    05162 Measles     122217892 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     122217892 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     122217892 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     122217892 (IL2)    05321 Inflammatory bowel disease     122217892 (IL2)    05330 Allograft rejection     122217892 (IL2)    05332 Graft-versus-host disease     122217892 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     122217892 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122217892 (IL2)    00536 Glycosaminoglycan binding proteins [BR:plez00536]     122217892 (IL2) Cytokines and neuropeptides [BR:plez04052]  Cytokines   Interleukins    122217892 (IL2) Glycosaminoglycan binding proteins [BR:plez00536]  Heparan sulfate / Heparin   Cytokines    122217892 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Leg1 Motif Other DBs NCBI-GeneID:  122217892 NCBI-ProteinID:  XP_042791513 UniProt:  A0A8C8X6A9 LinkDB All DBs Position B1:101518244..101522773 Genome browser AA seq 154 aa AA seqDB search MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS ETRFTCKYDDETATIVEFLNKWITFCQSIFSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc acatttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct gaaacaagattcacatgtaaatatgatgatgagacagcaaccattgtagaatttctgaac aaatggattaccttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system