Panthera leo (lion): 122219430 Help Entry 122219430         CDS       T10741                                  Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism plez  Panthera leo (lion) Pathway plez04613   Neutrophil extracellular trap formation plez05034   Alcoholism plez05203   Viral carcinogenesis plez05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:plez00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122219430  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     122219430   09163 Immune disease    05322 Systemic lupus erythematosus     122219430   09165 Substance dependence    05034 Alcoholism     122219430  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:plez03036]     122219430   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plez04147]     122219430 Chromosome and associated proteins [BR:plez03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122219430 Exosome [BR:plez04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122219430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  122219430 NCBI-ProteinID:  XP_042793613 LinkDB All DBs Position B2:complement(2760137..2760755) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtccgccccggccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aaatacaccagcgcaaagtga

DBGET integrated database retrieval system