Panthera leo (lion): 122219448 Help Entry 122219448         CDS       T10741                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism plez  Panthera leo (lion) Pathway plez04613   Neutrophil extracellular trap formation plez05034   Alcoholism plez05203   Viral carcinogenesis plez05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:plez00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122219448  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     122219448   09163 Immune disease    05322 Systemic lupus erythematosus     122219448   09165 Substance dependence    05034 Alcoholism     122219448  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:plez03036]     122219448 Chromosome and associated proteins [BR:plez03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122219448 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  122219448 NCBI-ProteinID:  XP_042793634 LinkDB All DBs Position B2:3713973..3714414 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcgggaagggcctgggcaaggggggcgcgaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcacgaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccgggctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggaacacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

DBGET integrated database retrieval system