Panthera leo (lion): 122228457 Help Entry 122228457         CDS       T10741                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism plez  Panthera leo (lion) Pathway plez04080   Neuroactive ligand-receptor interaction plez04081   Hormone signaling Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     122228457 (PRLH)    04081 Hormone signaling     122228457 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122228457 (PRLH) Cytokines and neuropeptides [BR:plez04052]  Neuropeptides   GPCR binding    122228457 (PRLH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prolactin_RP Motif Other DBs NCBI-GeneID:  122228457 NCBI-ProteinID:  XP_042809446 LinkDB All DBs Position C1:217156301..217157224 Genome browser AA seq 76 aa AA seqDB search MKAFQAWLLGLLLLGLALRGAASQTHPHSMEIRNPDIDPAWYAGRRIRPVGRFGRRTAAP PGCREPARLLPPERRR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaaggctttccaggcctggctgctgggcctgctgctgctgggactggccctgcggggg gctgcgagccaaacccacccgcactccatggagatccgcaaccctgacatcgatcccgcc tggtacgcgggccgcaggatcaggcccgtgggccgcttcggccggaggacagcagccccc ccgggatgtcgtgaaccagccaggctgctcccccctgaaaggaggcgctga

DBGET integrated database retrieval system