Panthera leo (lion): 122230307 Help Entry 122230307         CDS       T10741                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism plez  Panthera leo (lion) Brite KEGG Orthology (KO) [BR:plez00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:plez01002]     122230307 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:plez04147]     122230307 (CSTB) Peptidases and inhibitors [BR:plez01002]  Peptidase inhibitors   Family I25: cystatin family    122230307 (CSTB) Exosome [BR:plez04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    122230307 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Dynein_light Motif Other DBs NCBI-GeneID:  122230307 NCBI-ProteinID:  XP_042812025 UniProt:  A0A8C8XU18 LinkDB All DBs Position C2:2620188..2622992 Genome browser AA seq 98 aa AA seqDB search MMCGGSSATQPATAEIQAIADQVKPQLEEQENKKYTIFKAVEFRSQVVAGTNYFIKVQVD DDEFVHIRVFQSLPHENKPLALSSYQTHKARHDELAYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggggtcctccgccacgcagcccgccacggccgagatccaggccatcgcc gaccaggtgaagccccagctggaggagcaggagaataagaagtacactatctttaaggcg gtggagttcaggagccaggtggtcgcagggacgaactacttcatcaaggttcaagtcgat gatgacgagtttgtgcacattcgagtgtttcagagtctcccgcacgaaaacaaacccttg gccttgtccagctatcagacccacaaagccaggcacgacgaactggcgtatttctag

DBGET integrated database retrieval system