Pantoea ananatis LMG 5342: PANA5342_0179 Help Entry PANA5342_0179     CDS       T01728                                  Symbol yiiU Name (GenBank) cell division protein   KO K09892   cell division protein ZapB Organism plf  Pantoea ananatis LMG 5342 Brite KEGG Orthology (KO) [BR:plf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:plf03036]     PANA5342_0179 (yiiU) Chromosome and associated proteins [BR:plf03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PANA5342_0179 (yiiU) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CtIP_N Leu_zip KASH_CCD PspA_IM30 Nuf2_DHR10-like YabA DUF2968 DUF4795 Occludin_ELL DUF3450 Cep57_CLD_2 Herpes_UL6 V_ATPase_I Motif Other DBs NCBI-ProteinID:  CCF07572 LinkDB All DBs Position 190347..190586 Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNNLRHDAQNAAGNHEALMRENQHLKE EQHVWQERLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtgtttgagaaactggaagcaaaagtacagcaggcgattgatactatc accctgctgcaaatggaaattgaagagctgaaagagcagaacaacaacctgcgtcacgac gcgcagaatgctgctggcaaccatgaagcactgatgcgcgaaaatcagcatctgaaagag gagcagcatgtctggcaagaacgcctgcgtgcgctgttgggaaaaatggaagaggtataa

DBGET integrated database retrieval system