Pantoea ananatis LMG 5342: PANA5342_2741 Help Entry PANA5342_2741     CDS       T01728                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism plf  Pantoea ananatis LMG 5342 Pathway plf00998   Biosynthesis of various antibiotics plf01100   Metabolic pathways plf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PANA5342_2741 (acpP)    00074 Mycolic acid biosynthesis     PANA5342_2741 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PANA5342_2741 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 HLH Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  CCF10134 LinkDB All DBs Position complement(2871355..2871591) Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIISEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcatcagtgagcagctgggtgtgaaagag gaagaagtgaccaactctgcatctttcgtagaagacctgggtgccgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgatactgaaattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactatatcaatagccataaaggctaa

DBGET integrated database retrieval system