KEGG   Paucimonas lemoignei: NCTC10937_00714
Entry
NCTC10937_00714   CDS       T05492                                 
Symbol
msbA_1
Name
(GenBank) lipid A export ATP-binding/permease MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
plg  Paucimonas lemoignei
Pathway
plg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:plg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NCTC10937_00714 (msbA_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plg02000]
    NCTC10937_00714 (msbA_1)
Enzymes [BR:plg01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     NCTC10937_00714 (msbA_1)
Transporters [BR:plg02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    NCTC10937_00714 (msbA_1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 ABC_ATPase AAA_29 RsgA_GTPase nSTAND3 HUTI_composite_bact AAA_30 nSTAND1 DUF815 NB-ARC APS_kinase AAA_24 AAA_5 AAA_18
Other DBs
NCBI-ProteinID: SQF94661
LinkDB
Position
1:801667..803469
AA seq 600 aa
MTSSESSSPSSMKIYFRLLSYVRPYVGIFLVSIIGFVIFASTQPMLAGILKYFVDGLSNP
EAVLFPNVPYLRDLQLLQAVPLLIVLIAAWQGLGSFLGNYFLAKVSLGLVHDLRVELFNK
LLVLPNRYFDTHNSGHLISRITFNVTMVTGAATDAIKVVIREGLTIVFLFAYLLWMNWQL
TLVMLAILPLIATMVGSASKKFRKQSKKIQVAMGDVTHVASETIQNYRVVRSFGGEQYEQ
NRFGTASTSNTRKQLQMTKTGALYTPMLQLVIYTAMAVLMFLVLYLRGDATAGDLVAYIT
AASLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEPEVDSGTVERERVTGHLEVKNLSF
TYPGTERQVLNDISFSVAPGQMVALVGRSGSGKSTLASLLPRFYQHSIGEVLLDGVEISD
YQLRNLRRHISQVTQSVTLFNDSVANNIAYGDLAGAPRADIEAAAADAYAKEFIEQLPEG
LDTQVGENGVLLSGGQRQRLAIARALLKNAPVLILDEATSALDTESERHIQAALDNAMHG
RTTLVIAHRLSTIEKADLILVMDGGRIVERGTHAQLLAQNGYYSRLHAMGLDGPAPVGAI
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgacatcctccgaatcgtccagcccatcaagcatgaaaatttactttcgcttgttgtcc
tatgtgcgtccgtatgtagggatattcctggtcagtatcataggcttcgttatcttcgct
tcgacccagccgatgctggcgggcattttgaagtatttcgtcgacggtctgagcaatccc
gaggcagtgctgttccccaacgtaccctatttgcgcgacctgcagctgttgcaggccgtg
ccgctgttgattgtcttgatcgccgcctggcaggggctggggtcttttctgggtaactat
tttctggccaaggtttcccttgggctggtccacgatctgcgggtcgagttgttcaacaag
ttgctggtgctgccgaaccgttatttcgatacccacaactccggccacctgatttcccgc
atcacgttcaacgtcaccatggttaccggtgccgcgaccgatgcaatcaaagtggtgatt
cgtgaaggtctgaccatcgttttcctgttcgcctacctgctgtggatgaactggcagctg
accctggtcatgctggccattctgccgctgatcgcgaccatggtcggcagcgccagcaag
aaatttcgcaagcaaagcaaaaagatccaggtcgccatgggtgacgtgacccacgtggcg
tccgagactattcagaactaccgcgtggtgcgcagtttcggcggcgaacagtacgagcaa
aatcgtttcggcactgccagcaccagcaacacgcgcaagcaattgcagatgaccaagacc
ggcgcgctgtacaccccgatgctgcagctggtgatctacaccgccatggccgtgctgatg
ttcctggttctgtatcttcgcggtgatgccacggcgggagatctggtggcctacatcacc
gctgccagcctgctgcccaagccgattcgtcagctgtcggaagtcagttcgaccatccag
aagggtgtcgctggcgccgagagcatcttcgaacagctggacgtcgagcccgaagtcgac
agcggtaccgtcgagcgtgaacgtgtcactggccatcttgaagtgaagaacctcagcttt
acctaccctggcaccgagcggcaggtgttgaacgacatcagtttctccgttgctccgggg
cagatggtggcgctggtgggccgttccgggagcggtaaatcgacgctggcgagcctgttg
ccgcgcttttatcagcacagcattggtgaagttcttctcgatggtgtggagatcagcgac
tatcagttgcgcaacctgcgtcggcatatttctcaggtaacccagagcgtcacgctgttc
aacgacagcgtcgccaataacatcgcctacggcgacctggcgggcgcgccgcgtgcggat
atcgaagccgccgccgccgatgcctacgccaaggaattcatcgagcaattgccagaagga
ctggacactcaggtcggcgagaacggcgtgctgctttcaggcggtcagcgtcagcgtctg
gcgattgcccgggcgctcctgaaaaacgccccggtgttgatcctcgatgaggccacctcg
gcgctggacactgaatccgagcgccacatccaggccgcgctggacaacgccatgcacggg
cgcaccacgctggtcatcgctcaccggctgtcgaccatcgagaaggctgatctgattctg
gtcatggatggcgggcggatcgtcgagcgtggcacccatgcgcagctgctggcgcaaaat
ggctactactcgcgtctgcatgccatgggcctggatgggcccgcgccggtcggggcgatt
tag

DBGET integrated database retrieval system