Planctomyces sp. SH-PL62: VT85_02885 Help Entry VT85_02885        CDS       T04401                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism plh  Planctomyces sp. SH-PL62 Brite KEGG Orthology (KO) [BR:plh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:plh03110]     VT85_02885 (groS)    03029 Mitochondrial biogenesis [BR:plh03029]     VT85_02885 (groS) Chaperones and folding catalysts [BR:plh03110]  Heat shock proteins   HSP10    VT85_02885 (groS) Mitochondrial biogenesis [BR:plh03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     VT85_02885 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Cupin_2 MazE_antitoxin Phage_tube_C MPI_cupin_dom Motif Other DBs NCBI-ProteinID:  AMV36356 LinkDB All DBs Position 751373..751663 Genome browser AA seq 96 aa AA seqDB search MNLKPLGDRVVVEREEAKGTTAGGIVLPETAKDKPQKGKVVSVGEGRVTKDGKRRELQVK PGDVVIFTSYAGEEFKLDGDKKVLLMREDDILAVVG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatctgaagccgttgggagatcgcgtggtcgtcgagcgggaagaggccaaggggacc accgccggcgggatcgtgctgccggagaccgccaaggacaagccccagaaggggaaggtc gtttcggtgggcgaaggccgcgtgacgaaggacggcaagcgtcgcgagcttcaggtcaag cccggcgacgtcgtgatcttcacctcgtacgcgggcgaggaattcaagctcgacggcgac aagaaggtcctgctcatgcgcgaggacgacatcctcgcggtcgtcggctga

DBGET integrated database retrieval system