Planctomyces sp. SH-PL62: VT85_12180 Help Entry VT85_12180        CDS       T04401                                  Name (GenBank) Anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism plh  Planctomyces sp. SH-PL62 Pathway plh02020   Two-component system plh02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:plh00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     VT85_12180  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     VT85_12180  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:plh02035]     VT85_12180 Bacterial motility proteins [BR:plh02035]  Flagellar system   Flagellar assembly proteins    Others     VT85_12180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AMV38189 UniProt:  A0A142YG95 LinkDB All DBs Position complement(3108972..3109253) Genome browser AA seq 93 aa AA seqDB search MEIFGAGGAQGPQPIYPRLAPFSVDAGNTVHAGAPRDQVEISPLGQMLDGISRLPEIRHE RVEEIRRQIAEGTYDTPERLELALDRMFSEILG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaaatcttcggcgcagggggcgcgcaaggccctcaacccatctacccgcgactggcc ccgttcagcgttgacgccggcaacacggttcacgccggggctcctcgcgaccaggtcgaa atctcgcccctcggccagatgctcgacggcatcagccgactccccgagatccgtcacgag cgggtcgaagaaatccgacgccagatcgccgaagggacctacgacacccccgaacggctc gaactggccctcgaccggatgttctccgaaatcctcggctga

DBGET integrated database retrieval system