KEGG   Planctomyces sp. SH-PL62: VT85_19375
Entry
VT85_19375        CDS       T04401                                 
Symbol
lysN
Name
(GenBank) 2-aminoadipate transaminase
  KO
K05825  2-aminoadipate transaminase [EC:2.6.1.-]
Organism
plh  Planctomyces sp. SH-PL62
Pathway
plh00300  Lysine biosynthesis
plh00630  Glyoxylate and dicarboxylate metabolism
plh01100  Metabolic pathways
plh01110  Biosynthesis of secondary metabolites
plh01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:plh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VT85_19375 (lysN)
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    VT85_19375 (lysN)
SSDB
Motif
Pfam: Aminotran_1_2 Asp_aminotransf
Other DBs
NCBI-ProteinID: AMV39605
LinkDB
Position
4951880..4953181
AA seq 433 aa
MTRPIHLSAATARTSAPSISSLIKLALERPQIVSLAAGFVDQQSLPVETTALAAAQILGD
APAGRAALQYGTTIGDEALRAILIERLEVQHGVPPGSYRRAVDRTILTTGSAQLIYLVGE
ALLDPGDVVIVEAPTYFVFLGPLETRGARAIRTPIDGQGLRIDALEATFERLRAEGSLDK
VKLVYTIPEHSNPTGISLAAERRKPLVDLVRRWSDEAGHRIYLLEDSAYHGLSYDSKEAD
SLWSLDSEGETVILARTFSKTYSPGMKLGYGVLPGGLVDPVLTLKGNHDFGTSNFIQKLI
RLVLANGEYDRQVERLKGVYARKRDVFLEALERHFEPIRDRVSWTRPHGGLYVWMTLPES
VDTGFDGPLFRRCLEQDVIYVPGEFAFAPEPSAPPRNHLRLTYGVPDEAALAEGARRLAE
AVRETLDSPEGPA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgacacgacccatccatctcagcgcggcgaccgcccggaccagcgccccctcgatcagc
agcctgatcaagctcgcgctggagcgtccgcagatcgtgtccctggcggcgggattcgtc
gaccagcagtcgctcccggtcgagaccacggccctcgccgcggcccagattttgggagac
gcgccggcggggcgtgccgcgctgcaatacggaacgacgattggcgacgaggccctgcgg
gcgatcctgatcgaacggctggaggtccagcacggggtcccccccggcagttaccggcgg
gccgtggatcggacgatcctgaccaccgggtccgcccagctcatctacctcgtcggcgag
gcgctcctcgaccccggcgacgtcgtgatcgtcgaggcgccgacctacttcgtcttcctc
ggccccctggagacccgaggggcccgcgcgatccgcacgcccatcgacggccaggggctc
cggatcgacgccctggaagcgaccttcgagcggctccgcgccgagggctcgctcgacaag
gtcaaactcgtctacacgatccccgagcactcgaaccccacggggatcagcctggccgcc
gagcgtcgcaagccgctggtggacctggtccggcgctggtcggacgaggcgggccaccgc
atctatctcctggaggactccgcctaccacggactctcctacgactcgaaggaggccgac
agcctctggagcctcgactccgagggggagacggtgatcctggcccggaccttcagcaag
acgtacagcccggggatgaagctgggctacggcgtgctccccggcggcctggtggatccc
gtcctcacgctcaaggggaaccacgatttcgggacttcgaacttcatccagaagctgatc
cgtctggtcctcgccaacggcgagtacgaccgccaggtcgagcggttgaagggcgtctac
gcccggaagcgggacgtcttcctggaggccctggaacgccacttcgagccgattcgcgac
cgcgtgagctggacgcggccccacggcgggctctacgtctggatgacgctgccggagtcg
gtcgataccggattcgacgggccgctgttccgacgctgcctcgagcaagacgtgatctac
gtgcccggggagttcgccttcgccccggaaccgtccgcgccgcctcgcaaccacctgagg
ctgacttacggcgtccccgacgaggccgcgctggcggaaggcgcccggcggctcgccgag
gccgtccgcgagacgctcgattcgcccgaagggccggcctga

DBGET integrated database retrieval system