Paracoccus liaowanqingii: E4191_00825 Help Entry E4191_00825       CDS       T07041                                  Name (GenBank) hypothetical protein   KO K02395   peptidoglycan hydrolase FlgJ Organism plia  Paracoccus liaowanqingii Pathway plia02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:plia00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     E4191_00825  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:plia02035]     E4191_00825 Bacterial motility proteins [BR:plia02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     E4191_00825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  QBX33419 UniProt:  A0A4V1BIK0 LinkDB All DBs Position 185804..186049 Genome browser AA seq 81 aa AA seqDB search MQIDPLVPARGPKAGPHAVADQLEQAFLEEMLKYCGPSPAEGAFSGGAGEDQFASFLTRE HAALLARRLDLGFAAMLGARE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcagatcgaccccctcgtaccggcgcgcgggcccaaggccgggccccatgcggtcgcg gaccagctggaacaggcatttctggaggagatgctgaaatattgcggcccttccccggcc gagggcgccttttccggcggcgccggagaggatcagttcgccagcttcctgacgcgcgaa catgcggcgcttctggcccggcggctggacctgggattcgcggcgatgctgggcgcgcgg gaatga

DBGET integrated database retrieval system