Pseudomonas lijiangensis: KQP88_02030 Help Entry KQP88_02030       CDS       T08713                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plij  Pseudomonas lijiangensis Pathway plij00998   Biosynthesis of various antibiotics plij01100   Metabolic pathways plij01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plij00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KQP88_02030    00074 Mycolic acid biosynthesis     KQP88_02030   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KQP88_02030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QWU83602 UniProt:  A0ABX8HT34 LinkDB All DBs Position complement(443239..443493) Genome browser AA seq 84 aa AA seqDB search MQTREDIFETLRASMVELFELEPERVTLQANLYQDLEIDSIDAVDLIDHIKRKTGKKIAA EEFKSVRTVNDVVEAVYRMANPAE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgcgaagacattttcgagaccctgcgtgcgtccatggtcgagttgttcgag cttgagccggagcgcgtcaccctgcaagccaacctgtatcaggatctggaaatcgacagc atcgatgccgtagacctgatcgatcacatcaagcgcaagaccggcaagaaaatcgccgcc gaagagttcaagtcggtaagaacggtcaacgatgtagtcgaagccgtctatcgcatggcc aacccggcggaatga

DBGET integrated database retrieval system