Candidatus Planktophila limnetica: PHILAsVB114_02470 Help Entry PHILAsVB114_02470 CDS       T05067                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism plim  Candidatus Planktophila limnetica Brite KEGG Orthology (KO) [BR:plim00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     PHILAsVB114_02470 Enzymes [BR:plim01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      PHILAsVB114_02470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_9 Thioredoxin_2 Thioredoxin Glrx-like Motif Other DBs NCBI-ProteinID:  ASY27526 UniProt:  A0A249LF19 LinkDB All DBs Position 461219..461476 Genome browser AA seq 85 aa AA seqDB search MSKEQITMYGADWCGDCRRSKRLLAELGVQYTHIDVEEDLTAADKVREINGGAQSIPVIV FSDGTHLTEPSDMDLTAKLKSLSII NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagaacagatcactatgtatggtgctgactggtgcggagattgccgtcgctca aagagattactcgccgaattaggggtgcaatacacacacattgatgttgaagaagatctc actgcggccgacaaagttcgcgaaatcaacggcggcgctcaatcgattcctgtcattgtt ttttcagatgggactcatctaacagaaccatcagatatggatttaacagctaaattgaaa tctctttcaataatctaa

DBGET integrated database retrieval system