Planococcus liqunii: QWY22_18140 Help Entry QWY22_18140       CDS       T10306                                  Name (GenBank) hypothetical protein   KO K23264   phosphoribosylformylglycinamidine synthase subunit PurS [EC:6.3.5.3] Organism pliq  Planococcus liqunii Pathway pliq00230   Purine metabolism pliq01100   Metabolic pathways pliq01110   Biosynthesis of secondary metabolites Module pliq_M00048   De novo purine biosynthesis, PRPP + glutamine => IMP Brite KEGG Orthology (KO) [BR:pliq00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     QWY22_18140 Enzymes [BR:pliq01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor     6.3.5.3  phosphoribosylformylglycinamidine synthase      QWY22_18140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TOP_N DUF7635 Motif Other DBs NCBI-ProteinID:  WKA50793 LinkDB All DBs Position 3676158..3676445 Genome browser AA seq 95 aa AA seqDB search MNKLKSNSAALVMTGINPNAVLQTKQIGEARQIDPLTISKMLSSLVADITVQAINKQDLK KLVMPLEILRERLVENWAVLMDLIFSSKRLNASRI NT seq 288 nt NT seq  +upstreamnt  +downstreamnt ttgaataagctgaaaagcaacagtgccgcattggtaatgaccggcatcaatcccaatgca gttttgcagacaaaacagattggcgaggcgcggcagatagatccattgaccatcagcaag atgctttcctctcttgtagctgatatcactgttcaagcgattaataaacaggacttaaag aaattggtaatgccgctggagatacttcgggaacggttagtagaaaattgggcagttttg atggacctgattttctcatcgaagcggctgaacgcctcaaggatttga

DBGET integrated database retrieval system