Purpureocillium lilacinum: 28891214 Help Entry 28891214          CDS       T05029                                  Symbol PLICBS_004487 Name (RefSeq) dynein light chain   KO K10418   dynein light chain LC8-type Organism plj  Purpureocillium lilacinum Pathway plj04145   Phagocytosis plj04517   IgSF CAM signaling plj04814   Motor proteins Brite KEGG Orthology (KO) [BR:plj00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     28891214 (PLICBS_004487)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     28891214 (PLICBS_004487)   09142 Cell motility    04814 Motor proteins     28891214 (PLICBS_004487)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:plj03037]     28891214 (PLICBS_004487)    04812 Cytoskeleton proteins [BR:plj04812]     28891214 (PLICBS_004487) Cilium and associated proteins [BR:plj03037]  Motile cilia and associated proteins   Dynein arm    28891214 (PLICBS_004487) Cytoskeleton proteins [BR:plj04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      28891214 (PLICBS_004487) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light SGTA_dimer Cwc21_C WHD_GDS1 Motif Other DBs NCBI-GeneID:  28891214 NCBI-ProteinID:  XP_065456597 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MSEKQAETPSAPREKLEAQIKSADMTEDMQQESIEVAQEAMAKFTIEKDIAQHIKRTFDE RKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtctgagaagcaggcagagaccccgtctgccccgcgggagaagctcgaggcacagatt aagtctgccgacatgacggaggacatgcaacaagagtcgatcgaagttgcccaggaggcc atggccaagttcaccatcgagaaggacattgctcaacacatcaagcgcacatttgacgag cgcaagggcccgacctggcactgcatcgttggtcgcaactttggcagctttgtgacgcac gagacgaagcactttatctacttctacctcggccactgcgccatcctcctctttaagacc cagtag

DBGET integrated database retrieval system