Purpureocillium lilacinum: 90643372 Help Entry 90643372          CDS       T05029                                  Symbol PLICBS_008859 Name (RefSeq) uncharacterized protein   KO K27246   non-histone chromosomal protein 6 Organism plj  Purpureocillium lilacinum Brite KEGG Orthology (KO) [BR:plj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:plj03036]     90643372 (PLICBS_008859) Chromosome and associated proteins [BR:plj03036]  Eukaryotic type   Nucleosome assembly factors    Histone chaperones     FACT complex      90643372 (PLICBS_008859) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 Motif Other DBs NCBI-GeneID:  90643372 NCBI-ProteinID:  XP_065457549 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MRVWAEHPDMTPGQVGQILGEMWHAQTAAQRAPYERMAEEDKARYEAEVREWQAELERRD AEAR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgcgcgtctgggcagagcatccggacatgacgcccgggcaggtcggccagattctgggg gagatgtggcacgcgcagaccgccgcccagcgggccccgtacgagcgcatggctgaagag gacaaggcccgctatgaggccgaggtgcgggagtggcaggcagagcttgaacggcgagat gctgaggcgcgatga

DBGET integrated database retrieval system