Planococcus versutus: I858_013940 Help Entry I858_013940       CDS       T04421                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pll  Planococcus versutus Brite KEGG Orthology (KO) [BR:pll00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pll03032]     I858_013940    03036 Chromosome and associated proteins [BR:pll03036]     I858_013940    03400 DNA repair and recombination proteins [BR:pll03400]     I858_013940 DNA replication proteins [BR:pll03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I858_013940 Chromosome and associated proteins [BR:pll03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I858_013940 DNA repair and recombination proteins [BR:pll03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I858_013940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_2 Rpf1_C Motif Other DBs NCBI-ProteinID:  ANU28090 UniProt:  A0A1B1S4G7 LinkDB All DBs Position complement(1968551..1968823) Genome browser AA seq 90 aa AA seqDB search MNKTELVNSVAEAAELSRKDAAKAVDAAFETIQDALTKGEKVQLIGFGNFEVRERAARKG RNPQTGAEIEIAASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattagtgaactctgttgctgaagcagctgaactttctcgtaaagac gctgccaaagcagttgacgctgcatttgagacgattcaagacgctttaactaaaggtgaa aaagtacagttgatcggattcggtaactttgaagtacgcgaacgcgcggcccgcaaagga cgtaacccacaaactggtgctgaaatcgaaattgctgcaagcaaagttcctgcatttaag ccaggtaaagcgcttaaagacgcagtgaagtaa

DBGET integrated database retrieval system