Perognathus longimembris pacificus (Pacific pocket mouse): 125352329
Help
Entry
125352329 CDS
T08928
Name
(RefSeq) S-phase kinase-associated protein 1-like
KO
K03094
S-phase kinase-associated protein 1
Organism
plop
Perognathus longimembris pacificus (Pacific pocket mouse)
Pathway
plop03083
Polycomb repressive complex
plop04110
Cell cycle
plop04114
Oocyte meiosis
plop04120
Ubiquitin mediated proteolysis
plop04141
Protein processing in endoplasmic reticulum
plop04310
Wnt signaling pathway
plop04350
TGF-beta signaling pathway
plop04710
Circadian rhythm
plop05132
Salmonella infection
plop05170
Human immunodeficiency virus 1 infection
plop05200
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:
plop00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
125352329
04120 Ubiquitin mediated proteolysis
125352329
09126 Chromosome
03083 Polycomb repressive complex
125352329
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
125352329
04350 TGF-beta signaling pathway
125352329
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
125352329
04114 Oocyte meiosis
125352329
09150 Organismal Systems
09159 Environmental adaptation
04710 Circadian rhythm
125352329
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
125352329
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
125352329
09171 Infectious disease: bacterial
05132 Salmonella infection
125352329
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
plop04131
]
125352329
04121 Ubiquitin system [BR:
plop04121
]
125352329
03036 Chromosome and associated proteins [BR:
plop03036
]
125352329
Membrane trafficking [BR:
plop04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
125352329
Ubiquitin system [BR:
plop04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
125352329
Cul7 complex
125352329
Chromosome and associated proteins [BR:
plop03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
125352329
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
125352329
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
125352329
NCBI-ProteinID:
XP_048203381
LinkDB
All DBs
Position
6:63033123..63033801
Genome browser
AA seq
159 aa
AA seq
DB search
MPSIKLHSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDDPVPPPNVNAAILKKVIQWCTY
HEDDAPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVA
NMIKGQTPEEIRKTFNIKNDFTEEEEAQVRKENQCCEEK
NT seq
480 nt
NT seq
+upstream
nt +downstream
nt
atgccttcaattaagttacacagttctgatggagaaatttttgaagttgatgtagaaatt
gccaaacaatctgtgaccatcaagaccatgttggaagatttgggaatggatgatgaccca
gttcctccaccaaatgttaatgcagcgatattaaaaaaggtcattcagtggtgcacctac
cacgaggacgatgctcctcctcctgaggatgatgagaacaaagaaaagcgtacagatgat
attcctgtttgggaccaagaattcctgaaggttgaccaaggaacacttttcgaacttatt
ctggctgcaaactacttagatatcaaaggtttgcttgatgtcacatgcaaaactgttgcc
aatatgattaaggggcaaactcctgaggagattcgcaaaactttcaacatcaagaatgac
tttactgaagaggaggaagcccaggtacgaaaagagaaccagtgctgtgaagagaagtga
DBGET
integrated database retrieval system