Perognathus longimembris pacificus (Pacific pocket mouse): 125358229
Help
Entry
125358229 CDS
T08928
Symbol
Psmd7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
plop
Perognathus longimembris pacificus (Pacific pocket mouse)
Pathway
plop03050
Proteasome
plop05010
Alzheimer disease
plop05012
Parkinson disease
plop05014
Amyotrophic lateral sclerosis
plop05016
Huntington disease
plop05017
Spinocerebellar ataxia
plop05020
Prion disease
plop05022
Pathways of neurodegeneration - multiple diseases
plop05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
plop00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
125358229 (Psmd7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
125358229 (Psmd7)
09164 Neurodegenerative disease
05010 Alzheimer disease
125358229 (Psmd7)
05012 Parkinson disease
125358229 (Psmd7)
05014 Amyotrophic lateral sclerosis
125358229 (Psmd7)
05016 Huntington disease
125358229 (Psmd7)
05017 Spinocerebellar ataxia
125358229 (Psmd7)
05020 Prion disease
125358229 (Psmd7)
05022 Pathways of neurodegeneration - multiple diseases
125358229 (Psmd7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
plop03051
]
125358229 (Psmd7)
Proteasome [BR:
plop03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
125358229 (Psmd7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Coilin_N
Connexin
Motif
Other DBs
NCBI-GeneID:
125358229
NCBI-ProteinID:
XP_048211164
LinkDB
All DBs
Position
10:11157776..11165608
Genome browser
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATSKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKER
KDDKDKEKDKEKGDGKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagttggcggtgcagaaggtggtggtccaccccctggtgctgctcagcgtggtg
gaccacttcaaccgaatcggcaaggttggaaaccagaagcgcgttgttggtgtgcttttg
gggtcctggcaaaagaaagtacttgatgtatccaacagttttgcagtcccttttgacgaa
gatgacaaagatgattccgtctggtttttagaccatgattatttggaaaacatgtacgga
atgtttaagaaggtcaatgccagagagagaatagttggttggtaccatacaggccctaaa
ctccacaagaatgacatcgccatcaacgaactcatgaaaagatactgccctaactcagta
ttggtcattattgatgtgaaaccaaaggacctggggctgcccaccgaagcatatatctcc
gtggaggaggttcatgatgatggaacacccacatcaaaaacatttgagcacgtcaccagt
gagattggagcagaggaagccgaggaggttggagtggaacacttactaagggacatcaag
gataccacggtgggcacactctcacagcggatcacaaatcaggtccatggcttgaaggga
ctgaactctaagcttctggacatcaggagctacctggagaaagtagccacaagcaaactg
cccatcaaccaccagatcatataccagctgcaggacgtcttcaacctgctgccggacgtc
agcctgcaggagttcgtcaaggccttctacctgaagaccaatgaccagatggtggtggtg
tacctggcctcactgatccgctcggtggtcgccctgcataacctcatcaacaacaagatc
gccaaccgcgacgcggagaagaaggaagggcaggagaaggaggagagcaagaaggagagg
aaagatgacaaagacaaggaaaaagacaaagagaagggcgatggcaagaaagaggagaaa
aaggagaaaaagtaa
DBGET
integrated database retrieval system