Pseudomonas lundensis: AA042_03480 Help Entry AA042_03480       CDS       T05473                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plq  Pseudomonas lundensis Pathway plq01100   Metabolic pathways plq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AA042_03480    00074 Mycolic acid biosynthesis     AA042_03480   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AA042_03480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AOZ11822 UniProt:  A0A266N7Y1 LinkDB All DBs Position complement(802385..802621) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaactgggcgttaaagaa gaagaagtgaccaacagcgcttccttcgttgaagacctgggtgccgactcccttgacacc gttgagcttgtgatggctctggaagaggaattcgagaccgaaattcctgacgaagaagct gagaagatcactactgtacaagctgctatcgattacgttactgctcaccaggcgtaa

DBGET integrated database retrieval system