Pseudomonas lundensis: AA042_12205 Help Entry AA042_12205       CDS       T05473                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism plq  Pseudomonas lundensis Pathway plq01100   Metabolic pathways plq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:plq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AA042_12205    00074 Mycolic acid biosynthesis     AA042_12205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AA042_12205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding AvrPtoB-E3_ubiq Motif Other DBs NCBI-ProteinID:  AOZ13330 UniProt:  A0A266NB13 LinkDB All DBs Position complement(2680952..2681212) Genome browser AA seq 86 aa AA seqDB search MSDLNTQIKQLIIDALGLEDISTHDIDDEQTLFGEGLGLDSVDALELGLAIQKTYGIKID ADAKDTRDHFSNVASLAAFVTAKQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgaacacgcaaattaaacaactgatcatcgatgccctgggcctcgaagac atcagcacccacgacatcgacgacgaacagaccctgttcggcgaaggcctcgggctggat tcggttgacgcgctggagctgggcctggccattcaaaagacctacggcatcaaaatagac gccgacgccaaagacacccgcgatcatttttccaacgtggccagccttgcggcttttgtc actgccaaacaggccgcctga

DBGET integrated database retrieval system