Pseudomonas lundensis: AA042_12660 Help Entry AA042_12660       CDS       T05473                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism plq  Pseudomonas lundensis Pathway plq02024   Quorum sensing plq03018   RNA degradation Brite KEGG Orthology (KO) [BR:plq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AA042_12660  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AA042_12660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:plq03019]     AA042_12660    03036 Chromosome and associated proteins [BR:plq03036]     AA042_12660 Messenger RNA biogenesis [BR:plq03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AA042_12660 Chromosome and associated proteins [BR:plq03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AA042_12660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Gag_p24_C Motif Other DBs NCBI-ProteinID:  AOZ13406 UniProt:  A0A266NF02 LinkDB All DBs Position 2806011..2806271 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSAAESEQADAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaatactttgcgtaaagagaaggtt ggcgtttccatctacctggtcaacgggatcaagctgcaggggaccatcgagtctttcgac cagttcgtgattctgctgaaaaacaccgtcagccaaatggtttacaaacacgctatctcg acagtcgttcctgtgcgtccaattcgtctgccaagcgcagcagaatcggaacaagcagac gctgagccaggtaacgcctga

DBGET integrated database retrieval system