Pseudomonas lundensis: AA042_17225 Help Entry AA042_17225       CDS       T05473                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism plq  Pseudomonas lundensis Brite KEGG Orthology (KO) [BR:plq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:plq03032]     AA042_17225    03036 Chromosome and associated proteins [BR:plq03036]     AA042_17225    03400 DNA repair and recombination proteins [BR:plq03400]     AA042_17225 DNA replication proteins [BR:plq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AA042_17225 Chromosome and associated proteins [BR:plq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AA042_17225 DNA repair and recombination proteins [BR:plq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AA042_17225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 Barstar Motif Other DBs NCBI-ProteinID:  AOZ14196 UniProt:  A0A266NBY4 LinkDB All DBs Position 3800705..3800977 Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAASADIPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARTG RNPQTGKTLEIPAAKKPGFKAGKALKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcggaactgattgatgctatcgctgcatctgctgatatcccgaaagctgcc gccggccgtgcgctggacgcagtaatcgaatccgtcactggcgctcttaaggctggcgac tctgtggtactggttggctttggtactttttctgtaaccgatcgtcctgctcgtactggt cgtaacccacagaccggtaaaacgctggaaattcctgctgctaaaaagccaggtttcaaa gccggtaaagcgctgaaagaagccgttaactga

DBGET integrated database retrieval system