Planctomyces sp. SH-PL14: VT03_13250
Help
Entry
VT03_13250 CDS
T04354
Symbol
accC
Name
(GenBank) Biotin carboxylase
KO
K01961
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:
6.4.1.2
6.3.4.14
]
Organism
pls
Planctomyces sp. SH-PL14
Pathway
pls00061
Fatty acid biosynthesis
pls00620
Pyruvate metabolism
pls00640
Propanoate metabolism
pls00720
Other carbon fixation pathways
pls01100
Metabolic pathways
pls01110
Biosynthesis of secondary metabolites
pls01120
Microbial metabolism in diverse environments
pls01200
Carbon metabolism
pls01212
Fatty acid metabolism
Module
pls_M00082
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:
pls00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
VT03_13250 (accC)
00640 Propanoate metabolism
VT03_13250 (accC)
09102 Energy metabolism
00720 Other carbon fixation pathways
VT03_13250 (accC)
09103 Lipid metabolism
00061 Fatty acid biosynthesis
VT03_13250 (accC)
Enzymes [BR:
pls01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
VT03_13250 (accC)
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
VT03_13250 (accC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Dala_Dala_lig_C
ATP-grasp
RimK
ATP-grasp_3
ATP-grasp_5
ATPgrasp_ST
DUF7354
Motif
Other DBs
NCBI-ProteinID:
AMV18850
LinkDB
All DBs
Position
complement(3373459..3374802)
Genome browser
AA seq
447 aa
AA seq
DB search
MFNRILIANRGEIALRVMRACKELGIQTVAVFSEADRGAHYLSMADEAFCIGPAQASESY
LRVDRIISAAEVGNVDAIHPGYGFLSENYLFAEQCRAANIEFIGPPHDAMHALGDKVAAR
RIARKAKVPTVPGSEGLVESEEEAVRVAKEIGYPVLIKATAGGGGKGIRPAMDEKMLRVE
LKAAANEAEKAFKNGGVYIEKFVQKPRHVEVQLIGDQHGNVLHLWERDCTMQRKHQKLIE
ESPAPNLPQKIREQLCEAAVRLAKTAGYYNAGTCEFIVDQENNFYFIEVNARIQVEHPVT
EQVTGIDLIKSQILVAAGEKLPMKQREIGQYGHAIEVRINAEDPDNGFRGCPGTITKLRV
PGGFGVRFDSHVHEGYKITPYYDSMIGKLIVHKQDRAEAIKTTKRALDEFVVEGIKTSIP
MARRILDTTVFNEGTGDTKYVERELLK
NT seq
1344 nt
NT seq
+upstream
nt +downstream
nt
atgttcaatcgcatcctgatcgccaaccgcggggaaatcgctctgcgggtcatgcgggcc
tgcaaggaactcggcatccagaccgtcgccgtcttcagcgaggcggaccgcggggcccac
tacctgagcatggcggacgaggcgttctgcatcggccccgcgcaggcgagcgagagctac
ctgcgggtcgaccggatcatcagcgccgccgaagtcggcaacgtcgacgcgatccacccc
ggatatggcttcctctcggagaactacctcttcgccgagcagtgccgggcggccaacatc
gagttcatcggcccgccgcacgacgcgatgcacgccctcggtgacaaggtcgcggcccgc
cgcatcgcccggaaggcgaaggtcccgaccgttcccggcagcgaagggctcgtcgagagc
gaagaggaagcggtccgggtcgcgaaggaaatcggctacccggtcctgatcaaggcgaca
gccggcggcgggggcaaaggcatccgccccgccatggacgagaagatgctccgcgtcgag
ctgaaggccgcggccaacgaggccgagaaggcgttcaagaacggcggggtctacatcgag
aagttcgtccagaagccgcggcacgtcgaagtccagctcatcggcgaccagcacggcaat
gtgctgcacctgtgggaacgcgactgcacgatgcagcggaagcaccagaagctgattgaa
gagagcccggcgccgaacctgccgcagaagattcgcgagcagctctgcgaagcggccgtc
cggctggcgaagaccgccggctactacaacgccggaacgtgcgagttcatcgtcgatcag
gagaacaacttctacttcatcgaggtcaacgcccggatccaggtcgagcacccggtgacg
gagcaggtgaccgggatcgacctgatcaagtcgcagatcctcgtcgcggcgggcgagaag
ctgccgatgaagcagagggagatcgggcagtacggccacgcgattgaggtccggatcaac
gccgaggacccggacaacggcttccgcggctgtccgggaacgatcacgaagctccgcgtc
cccggcggctttggcgtgcggttcgattcgcatgtccacgaaggctacaagatcacgccg
tactacgactcgatgatcggcaagctgatcgttcacaagcaggaccgggccgaggcgatc
aagacgacgaagcgggctctcgacgagttcgtcgtggaagggatcaagacctcgatcccg
atggcccgccggatcctcgacacgacggtcttcaacgaagggaccggcgacacgaagtac
gtcgagcgcgagctgctcaagtag
DBGET
integrated database retrieval system