Planctomyces sp. SH-PL14: VT03_27000 Help Entry VT03_27000        CDS       T04354                                  Symbol flgJ Name (GenBank) Peptidoglycan hydrolase FlgJ   KO K02395   peptidoglycan hydrolase FlgJ Organism pls  Planctomyces sp. SH-PL14 Pathway pls02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pls00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     VT03_27000 (flgJ)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pls02035]     VT03_27000 (flgJ) Bacterial motility proteins [BR:pls02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     VT03_27000 (flgJ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  AMV21581 UniProt:  A0A142X3X5 LinkDB All DBs Position 6940612..6940923 Genome browser AA seq 103 aa AA seqDB search MNPLSSVLPAGSYDAGLGLSGKSETEAAKQLESLFVSLLLKEMRQTIGSEDGFAGDKSDT IGGLFDQYMGEHMAAGGGLGIADSLRGALLRDAGGAGVGGSGT NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaatcccctgtcatccgtcctgccggccggttcgtacgacgccgggctcggtctcagc ggcaagtcggaaaccgaagcggcgaagcagctcgagtcgctgttcgtttcgctgctcctc aaggaaatgcggcagacgatcggctcggaagacgggtttgccggagacaagtccgacacg atcggcgggctgttcgaccagtacatgggcgaacacatggccgcgggggggggcctgggg atcgccgactcgctccgcggcgcgctgctgcgggatgcggggggcgctggagtgggagga agcggcacgtga

DBGET integrated database retrieval system